BLASTX nr result
ID: Mentha25_contig00014004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00014004 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-lik... 77 3e-12 ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-lik... 77 3e-12 ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-lik... 75 1e-11 gb|EYU46000.1| hypothetical protein MIMGU_mgv1a000719mg [Mimulus... 73 5e-11 ref|XP_002517728.1| conserved hypothetical protein [Ricinus comm... 68 2e-09 gb|EPS69416.1| hypothetical protein M569_05346 [Genlisea aurea] 67 3e-09 ref|XP_006468148.1| PREDICTED: protein TIC110, chloroplastic-lik... 65 8e-09 ref|XP_007204960.1| hypothetical protein PRUPE_ppa000779mg [Prun... 65 8e-09 gb|EXB28414.1| hypothetical protein L484_002222 [Morus notabilis] 65 1e-08 ref|XP_003551181.1| PREDICTED: protein TIC110, chloroplastic-lik... 65 1e-08 ref|XP_002319406.2| chloroplast inner envelope family protein [P... 63 4e-08 ref|XP_004500340.1| PREDICTED: protein TIC110, chloroplastic-lik... 61 2e-07 ref|XP_002276796.2| PREDICTED: protein TIC110, chloroplastic-lik... 61 2e-07 emb|CAN60839.1| hypothetical protein VITISV_038562 [Vitis vinifera] 61 2e-07 ref|XP_004296031.1| PREDICTED: protein TIC110, chloroplastic-lik... 60 3e-07 ref|XP_004162715.1| PREDICTED: protein TIC110, chloroplastic-lik... 60 3e-07 ref|XP_004153267.1| PREDICTED: protein TIC110, chloroplastic-lik... 60 3e-07 ref|XP_004145231.1| PREDICTED: protein TIC110, chloroplastic-lik... 60 3e-07 ref|XP_007017042.1| Translocon at the inner envelope membrane of... 59 5e-07 ref|XP_003544919.1| PREDICTED: protein TIC110, chloroplastic-lik... 59 7e-07 >ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 1003 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 +DLF+VYLKS+ PEK+ R+QYLL ISDSTAE+LRA+KD+ NGA EEEFVF Sbjct: 951 SDLFIVYLKSDPPPEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1003 >ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 1004 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 +DLF+VYLKS+ PEK+ R+QYLL ISDSTAE+LRA+KD+ NGA EEEFVF Sbjct: 952 SDLFIVYLKSDPPPEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1004 >ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-like [Solanum lycopersicum] Length = 1005 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 +DLF+VYLKS+ PEK+ R+QYLL ISDSTAE+LR +KD+ NGA EEEFVF Sbjct: 953 SDLFIVYLKSDPPPEKLSRLQYLLGISDSTAETLRTVKDRELPNGAGEEEFVF 1005 >gb|EYU46000.1| hypothetical protein MIMGU_mgv1a000719mg [Mimulus guttatus] Length = 1006 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 1/54 (1%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGA-AEEEFVF 160 ADLFLVYLKS+Q EKV RVQYLL+I+D+ AE+LR KD G NGA AEEEFVF Sbjct: 953 ADLFLVYLKSDQAAEKVARVQYLLSINDAAAEALRNAKDNGLPNGAKAEEEFVF 1006 >ref|XP_002517728.1| conserved hypothetical protein [Ricinus communis] gi|223543126|gb|EEF44660.1| conserved hypothetical protein [Ricinus communis] Length = 1019 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/53 (60%), Positives = 42/53 (79%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +Y+K++ PEK+ R+QYLL ISDSTA +LR MKD+ + GA EE+FVF Sbjct: 967 ADLFTIYMKNDPAPEKLSRLQYLLGISDSTAAALREMKDRVPSVGAEEEKFVF 1019 >gb|EPS69416.1| hypothetical protein M569_05346 [Genlisea aurea] Length = 1179 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 5/56 (8%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANG-----AAEEEF 154 ADLFLVYLKS+ PEK +RV+YLLNISDSTAESL A+KD G A EEEF Sbjct: 1001 ADLFLVYLKSDPSPEKADRVKYLLNISDSTAESLAAVKDDGEVAALPGKVANEEEF 1056 >ref|XP_006468148.1| PREDICTED: protein TIC110, chloroplastic-like [Citrus sinensis] Length = 1009 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/53 (62%), Positives = 39/53 (73%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +Y+KSN PEK+ R+QYLL ISDSTA +LR M D + GA EE FVF Sbjct: 957 ADLFNIYMKSNPAPEKLTRLQYLLGISDSTAAALREMGDSLLSAGAEEENFVF 1009 >ref|XP_007204960.1| hypothetical protein PRUPE_ppa000779mg [Prunus persica] gi|462400602|gb|EMJ06159.1| hypothetical protein PRUPE_ppa000779mg [Prunus persica] Length = 1006 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/53 (62%), Positives = 40/53 (75%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +YLKS+ PEK+ R+QYLL+I+DSTA SLR M D+ GA EE FVF Sbjct: 954 ADLFAIYLKSDPAPEKLLRLQYLLDINDSTAASLREMGDRLQTIGAEEENFVF 1006 >gb|EXB28414.1| hypothetical protein L484_002222 [Morus notabilis] Length = 1018 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ +YLKS PEK+ R+QYLL ISDSTA +LR M D+ + GA EE+FVF Sbjct: 966 ADLYTIYLKSEPAPEKLSRLQYLLGISDSTAAALREMGDRVLSIGAEEEKFVF 1018 >ref|XP_003551181.1| PREDICTED: protein TIC110, chloroplastic-like [Glycine max] Length = 990 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ +Y+KSN PEK+ R+QYLL I+DSTA SLR M ++ +N A EEFVF Sbjct: 938 ADLYTIYMKSNATPEKLSRLQYLLGINDSTAASLREMGERLLSNNAEVEEFVF 990 >ref|XP_002319406.2| chloroplast inner envelope family protein [Populus trichocarpa] gi|550325883|gb|EEE95329.2| chloroplast inner envelope family protein [Populus trichocarpa] Length = 1011 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/53 (56%), Positives = 40/53 (75%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ +++K+N PEK+ R+QYLL ISDSTA +L MKD+ GA EE+FVF Sbjct: 959 ADLYTIHMKNNPAPEKLSRLQYLLGISDSTATALGEMKDRVPPVGAEEEKFVF 1011 >ref|XP_004500340.1| PREDICTED: protein TIC110, chloroplastic-like [Cicer arietinum] Length = 994 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ +Y+K N PEK+ R+QYLL I+DSTA +LR M D+ + EEEFVF Sbjct: 942 ADLYTIYMKRNPTPEKLTRMQYLLGINDSTAAALREMGDRLINSAVEEEEFVF 994 >ref|XP_002276796.2| PREDICTED: protein TIC110, chloroplastic-like [Vitis vinifera] gi|297745792|emb|CBI15848.3| unnamed protein product [Vitis vinifera] Length = 1007 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +Y+KS+ PEK+ R+QYLL ISDSTA +LR M D+ G EEEFVF Sbjct: 956 ADLFAIYMKSDPAPEKLSRLQYLLGISDSTAATLREMGDRVLQIG-TEEEFVF 1007 >emb|CAN60839.1| hypothetical protein VITISV_038562 [Vitis vinifera] Length = 1061 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +Y+KS+ PEK+ R+QYLL ISDSTA +LR M D+ G EEEFVF Sbjct: 1010 ADLFAIYMKSDPAPEKLSRLQYLLGISDSTAXTLREMGDRVLQIG-TEEEFVF 1061 >ref|XP_004296031.1| PREDICTED: protein TIC110, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1011 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADLF +YLKS+ PEK+ R+QYLL I+DS A SLR + D+ S G AEE+FVF Sbjct: 960 ADLFAIYLKSDPAPEKLSRLQYLLGINDSMAASLREVGDRLSPAG-AEEKFVF 1011 >ref|XP_004162715.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 682 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ VY KS PEK+ R+QYLL I DSTA ++R M D+ GA EE FVF Sbjct: 630 ADLYSVYAKSEPTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 682 >ref|XP_004153267.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 596 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ VY KS PEK+ R+QYLL I DSTA ++R M D+ GA EE FVF Sbjct: 544 ADLYSVYAKSEPTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 596 >ref|XP_004145231.1| PREDICTED: protein TIC110, chloroplastic-like [Cucumis sativus] Length = 1014 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ VY KS PEK+ R+QYLL I DSTA ++R M D+ GA EE FVF Sbjct: 962 ADLYSVYAKSEPTPEKLSRLQYLLGIDDSTAAAIREMGDRLQPIGAEEENFVF 1014 >ref|XP_007017042.1| Translocon at the inner envelope membrane of chloroplasts 110 isoform 2 [Theobroma cacao] gi|508787405|gb|EOY34661.1| Translocon at the inner envelope membrane of chloroplasts 110 isoform 2 [Theobroma cacao] Length = 1015 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 AD+F +Y KSN PEK+ R+QYLL ISDS A +++ M D + GA EE+FVF Sbjct: 963 ADIFGIYAKSNPAPEKLSRLQYLLGISDSVAAAVKEMGDGVLSAGAEEEKFVF 1015 >ref|XP_003544919.1| PREDICTED: protein TIC110, chloroplastic-like [Glycine max] Length = 996 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 2 ADLFLVYLKSNQVPEKVERVQYLLNISDSTAESLRAMKDKGSANGAAEEEFVF 160 ADL+ +YLKS+ PE + R+QYLL I+DSTA +LR M D+ A EE+FVF Sbjct: 944 ADLYTIYLKSDPTPENLSRLQYLLGINDSTAAALREMGDRLLNTTAEEEKFVF 996