BLASTX nr result
ID: Mentha25_contig00013463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00013463 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74772.1| Ubiquitin-like-specific protease ESD4 [Morus nota... 87 2e-15 ref|XP_006380138.1| hypothetical protein POPTR_0008s222501g, par... 87 3e-15 ref|XP_006388884.1| EARLY IN SHORT DAYS 4 family protein [Populu... 87 3e-15 ref|XP_002516927.1| sentrin/sumo-specific protease, putative [Ri... 86 5e-15 ref|XP_004487849.1| PREDICTED: ubiquitin-like-specific protease ... 86 7e-15 ref|XP_006349816.1| PREDICTED: ubiquitin-like-specific protease ... 85 9e-15 ref|XP_002315520.2| hypothetical protein POPTR_0010s01730g [Popu... 85 9e-15 ref|XP_002275739.2| PREDICTED: ubiquitin-like-specific protease ... 85 1e-14 emb|CBI26051.3| unnamed protein product [Vitis vinifera] 85 1e-14 ref|XP_004296843.1| PREDICTED: ubiquitin-like-specific protease ... 84 2e-14 ref|XP_004252904.1| PREDICTED: ubiquitin-like-specific protease ... 84 3e-14 gb|EYU43956.1| hypothetical protein MIMGU_mgv1a004424mg [Mimulus... 83 4e-14 ref|XP_006489076.1| PREDICTED: ubiquitin-like-specific protease ... 83 4e-14 ref|XP_006489074.1| PREDICTED: ubiquitin-like-specific protease ... 83 4e-14 ref|XP_006419567.1| hypothetical protein CICLE_v10004735mg [Citr... 83 4e-14 ref|XP_004170858.1| PREDICTED: ubiquitin-like-specific protease ... 83 4e-14 ref|XP_004148212.1| PREDICTED: ubiquitin-like-specific protease ... 83 4e-14 gb|AFK40889.1| unknown [Lotus japonicus] 83 4e-14 ref|XP_006342801.1| PREDICTED: ubiquitin-like-specific protease ... 82 6e-14 ref|XP_004229242.1| PREDICTED: ubiquitin-like-specific protease ... 82 6e-14 >gb|EXB74772.1| Ubiquitin-like-specific protease ESD4 [Morus notabilis] Length = 550 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCGVFMIKYADFYSR +GLCF Q HMPYFRLRTAKEIL+LRAD Sbjct: 507 FDCGVFMIKYADFYSRGLGLCFGQEHMPYFRLRTAKEILRLRAD 550 >ref|XP_006380138.1| hypothetical protein POPTR_0008s222501g, partial [Populus trichocarpa] gi|550333659|gb|ERP57935.1| hypothetical protein POPTR_0008s222501g, partial [Populus trichocarpa] Length = 44 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIKYADFYSR IGLCF Q HMPYFRLRTAKEIL+LRAD Sbjct: 1 YDCGVFMIKYADFYSRGIGLCFGQEHMPYFRLRTAKEILRLRAD 44 >ref|XP_006388884.1| EARLY IN SHORT DAYS 4 family protein [Populus trichocarpa] gi|550311379|gb|ERP47798.1| EARLY IN SHORT DAYS 4 family protein [Populus trichocarpa] Length = 516 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIKYADFYSR IGLCF Q HMPYFRLRTAKEIL+LRAD Sbjct: 473 YDCGVFMIKYADFYSRGIGLCFGQEHMPYFRLRTAKEILRLRAD 516 >ref|XP_002516927.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223544015|gb|EEF45541.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 492 Score = 85.9 bits (211), Expect = 5e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIKYADFYSR IGLCF Q HMPYFR+RTAKEIL+LRAD Sbjct: 449 YDCGVFMIKYADFYSRGIGLCFGQEHMPYFRMRTAKEILRLRAD 492 >ref|XP_004487849.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Cicer arietinum] Length = 476 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCGVFMIKYADFYSR +GLCFNQ HMPYFR RTAKEIL+LRA+ Sbjct: 433 FDCGVFMIKYADFYSRGLGLCFNQEHMPYFRRRTAKEILRLRAE 476 >ref|XP_006349816.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Solanum tuberosum] Length = 523 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIK ADFYSRDIGLCFNQG MPYFR+RTAKE+L+L+AD Sbjct: 480 YDCGVFMIKNADFYSRDIGLCFNQGDMPYFRMRTAKELLRLKAD 523 >ref|XP_002315520.2| hypothetical protein POPTR_0010s01730g [Populus trichocarpa] gi|550328880|gb|EEF01691.2| hypothetical protein POPTR_0010s01730g [Populus trichocarpa] Length = 623 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIKYADFYSR +GLCF Q HMPYFRLRTAKEIL+L+AD Sbjct: 580 YDCGVFMIKYADFYSRGVGLCFGQEHMPYFRLRTAKEILRLKAD 623 >ref|XP_002275739.2| PREDICTED: ubiquitin-like-specific protease ESD4-like [Vitis vinifera] Length = 528 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCG+FMIKYADFYSR I LCFNQ HMPYFRLRTAKEILKL+AD Sbjct: 485 YDCGMFMIKYADFYSRGIELCFNQEHMPYFRLRTAKEILKLKAD 528 >emb|CBI26051.3| unnamed protein product [Vitis vinifera] Length = 556 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCG+FMIKYADFYSR I LCFNQ HMPYFRLRTAKEILKL+AD Sbjct: 513 YDCGMFMIKYADFYSRGIELCFNQEHMPYFRLRTAKEILKLKAD 556 >ref|XP_004296843.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Fragaria vesca subsp. vesca] Length = 513 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCGVFMIKYADFYSR + LCF+Q HMPYFRLRTAKE+L+LRAD Sbjct: 470 FDCGVFMIKYADFYSRGLDLCFHQKHMPYFRLRTAKEVLQLRAD 513 >ref|XP_004252904.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Solanum lycopersicum] Length = 522 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 +DCGVFMIK DFYSRDIGLCFNQG MPYFR+RTAKE+L+L+AD Sbjct: 479 YDCGVFMIKNVDFYSRDIGLCFNQGDMPYFRMRTAKELLRLKAD 522 >gb|EYU43956.1| hypothetical protein MIMGU_mgv1a004424mg [Mimulus guttatus] Length = 528 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FMIKYADFYSRDIGL F+Q HMPYFRLRTA EILKLRA+ Sbjct: 485 FDCGMFMIKYADFYSRDIGLRFSQEHMPYFRLRTANEILKLRAE 528 >ref|XP_006489076.1| PREDICTED: ubiquitin-like-specific protease ESD4-like isoform X3 [Citrus sinensis] Length = 520 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FM+KY DFYSR +GLCF+Q HMPYFR+RTAKEIL++RAD Sbjct: 477 FDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRAD 520 >ref|XP_006489074.1| PREDICTED: ubiquitin-like-specific protease ESD4-like isoform X1 [Citrus sinensis] gi|568871814|ref|XP_006489075.1| PREDICTED: ubiquitin-like-specific protease ESD4-like isoform X2 [Citrus sinensis] Length = 522 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FM+KY DFYSR +GLCF+Q HMPYFR+RTAKEIL++RAD Sbjct: 479 FDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRAD 522 >ref|XP_006419567.1| hypothetical protein CICLE_v10004735mg [Citrus clementina] gi|557521440|gb|ESR32807.1| hypothetical protein CICLE_v10004735mg [Citrus clementina] Length = 522 Score = 82.8 bits (203), Expect = 4e-14 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FM+KY DFYSR +GLCF+Q HMPYFR+RTAKEIL++RAD Sbjct: 479 FDCGMFMLKYVDFYSRGLGLCFDQSHMPYFRVRTAKEILRMRAD 522 >ref|XP_004170858.1| PREDICTED: ubiquitin-like-specific protease 1A-like, partial [Cucumis sativus] Length = 79 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FMIKYADFYSR + LCF Q HMPYFRLRTAKEILKLRA+ Sbjct: 36 FDCGMFMIKYADFYSRGLNLCFKQEHMPYFRLRTAKEILKLRAN 79 >ref|XP_004148212.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Cucumis sativus] Length = 501 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FMIKYADFYSR + LCF Q HMPYFRLRTAKEILKLRA+ Sbjct: 458 FDCGMFMIKYADFYSRGLNLCFKQEHMPYFRLRTAKEILKLRAN 501 >gb|AFK40889.1| unknown [Lotus japonicus] Length = 276 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 425 DCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 DCGVFMIKYADFY R++GLCF Q HMPYFRLRTAKEIL+L+AD Sbjct: 234 DCGVFMIKYADFYGRNLGLCFKQEHMPYFRLRTAKEILRLKAD 276 >ref|XP_006342801.1| PREDICTED: ubiquitin-like-specific protease ESD4-like isoform X1 [Solanum tuberosum] Length = 515 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FM+KYADFYSRDIGLCF+Q HMPYFR RT KEIL+L+A+ Sbjct: 472 FDCGMFMLKYADFYSRDIGLCFSQEHMPYFRSRTVKEILRLKAE 515 >ref|XP_004229242.1| PREDICTED: ubiquitin-like-specific protease ESD4-like [Solanum lycopersicum] Length = 515 Score = 82.4 bits (202), Expect = 6e-14 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 428 FDCGVFMIKYADFYSRDIGLCFNQGHMPYFRLRTAKEILKLRAD 297 FDCG+FM+KYADFYSRDIGLCF+Q HMPYFR RT KEIL+L+A+ Sbjct: 472 FDCGMFMLKYADFYSRDIGLCFSQEHMPYFRSRTVKEILRLKAE 515