BLASTX nr result
ID: Mentha25_contig00013430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00013430 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46216.1| hypothetical protein MIMGU_mgv1a023243mg, partial... 56 5e-07 >gb|EYU46216.1| hypothetical protein MIMGU_mgv1a023243mg, partial [Mimulus guttatus] Length = 1772 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 27/62 (43%), Positives = 42/62 (67%) Frame = -1 Query: 480 DEDLEMAEKIFLGNDPIELGGKKGDVSSTLETESTIQNSDMVREAECPTIIHDLVENGMA 301 D++ +E I L ND ++ KKG+ + +ETE+TI NSDMV++ EC + +LVE+G+ Sbjct: 1688 DKEFPSSENILLPNDFVD---KKGEALNAVETEATIHNSDMVKKDECLPLTQNLVEDGLT 1744 Query: 300 NN 295 NN Sbjct: 1745 NN 1746 Score = 23.5 bits (49), Expect(2) = 5e-07 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 287 LTSAADSACFDELELSSQTI 228 L S AD+A D ELS QT+ Sbjct: 1750 LESVADTALSDSTELSPQTV 1769