BLASTX nr result
ID: Mentha25_contig00013356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00013356 (701 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40660.1| hypothetical protein MIMGU_mgv1a015099mg [Mimulus... 61 3e-07 >gb|EYU40660.1| hypothetical protein MIMGU_mgv1a015099mg [Mimulus guttatus] Length = 168 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = -1 Query: 119 MAQEAQA---IAGAENGSKVSPVVFTAAKPWLVVEAPKANDA 3 MA+EAQ + AENGSK SPVVF A KPWLVVEAPKANDA Sbjct: 1 MAEEAQTTGVVVAAENGSKSSPVVFAAVKPWLVVEAPKANDA 42