BLASTX nr result
ID: Mentha25_contig00012969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00012969 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491322.1| PREDICTED: calcium-binding protein KIC-like ... 61 2e-07 ref|XP_006444792.1| hypothetical protein CICLE_v10022851mg [Citr... 61 2e-07 ref|XP_006362130.1| PREDICTED: calcium-binding protein KIC-like ... 59 7e-07 ref|XP_006386633.1| hypothetical protein POPTR_0002s17550g [Popu... 59 7e-07 ref|XP_007051487.1| Calcium-binding EF-hand family protein [Theo... 58 2e-06 ref|XP_004248089.1| PREDICTED: calcium-binding protein KIC-like ... 57 2e-06 ref|XP_004306641.1| PREDICTED: calcium-binding protein KIC-like ... 57 3e-06 ref|XP_003548273.1| PREDICTED: calcium-binding protein KIC-like ... 56 6e-06 ref|XP_003521817.1| PREDICTED: calcium-binding protein KIC-like ... 56 6e-06 ref|NP_001239896.1| uncharacterized protein LOC100801586 [Glycin... 56 6e-06 ref|XP_007147336.1| hypothetical protein PHAVU_006G115300g [Phas... 55 8e-06 ref|XP_002523300.1| ccd1, putative [Ricinus communis] gi|2235373... 55 8e-06 ref|XP_002320212.1| calcium-binding family protein [Populus tric... 55 8e-06 >ref|XP_006491322.1| PREDICTED: calcium-binding protein KIC-like [Citrus sinensis] Length = 157 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 231 TMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 T SEYEDLLPVM +KLD ESFV+ELCGGFRLLAD Sbjct: 43 TTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLLAD 79 >ref|XP_006444792.1| hypothetical protein CICLE_v10022851mg [Citrus clementina] gi|557547054|gb|ESR58032.1| hypothetical protein CICLE_v10022851mg [Citrus clementina] Length = 128 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 231 TMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 T SEYEDLLPVM +KLD ESFV+ELCGGFRLLAD Sbjct: 14 TTSTGSEYEDLLPVMAEKLDVESFVSELCGGFRLLAD 50 >ref|XP_006362130.1| PREDICTED: calcium-binding protein KIC-like [Solanum tuberosum] Length = 122 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 237 EPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 E +EY+DLLPVM +KLD E+FVAELCGGFRLLAD Sbjct: 8 EATTEYQDLLPVMAEKLDVEAFVAELCGGFRLLAD 42 >ref|XP_006386633.1| hypothetical protein POPTR_0002s17550g [Populus trichocarpa] gi|550345228|gb|ERP64430.1| hypothetical protein POPTR_0002s17550g [Populus trichocarpa] Length = 142 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 246 SEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 SEY+DLLPVM +KLD E+FV+ELCGGFRLLAD Sbjct: 36 SEYQDLLPVMAEKLDAEAFVSELCGGFRLLAD 67 >ref|XP_007051487.1| Calcium-binding EF-hand family protein [Theobroma cacao] gi|508703748|gb|EOX95644.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 126 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 246 SEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 S+YEDLLPVM +KLD E+FV+ELCGGFRLLAD Sbjct: 15 SQYEDLLPVMAEKLDVEAFVSELCGGFRLLAD 46 >ref|XP_004248089.1| PREDICTED: calcium-binding protein KIC-like [Solanum lycopersicum] Length = 123 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 237 EPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 E +EY+DLLPVM +KLD E+FVAELCGGFRLL+D Sbjct: 8 EGTTEYQDLLPVMAEKLDVEAFVAELCGGFRLLSD 42 >ref|XP_004306641.1| PREDICTED: calcium-binding protein KIC-like [Fragaria vesca subsp. vesca] Length = 117 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 246 SEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 +EY+DLLPVM +KLD E+FV+ELCGGFRLLAD Sbjct: 8 TEYQDLLPVMAEKLDVEAFVSELCGGFRLLAD 39 >ref|XP_003548273.1| PREDICTED: calcium-binding protein KIC-like isoform X1 [Glycine max] gi|571524944|ref|XP_006598892.1| PREDICTED: calcium-binding protein KIC-like isoform X2 [Glycine max] Length = 125 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 243 DSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 ++E+EDLLPVM +KLD ESFV+ELCGGF+LL+D Sbjct: 13 ETEFEDLLPVMAEKLDVESFVSELCGGFKLLSD 45 >ref|XP_003521817.1| PREDICTED: calcium-binding protein KIC-like [Glycine max] Length = 126 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 228 ITMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 IT+E + E+EDLLPVM +KLD E+FV+ELCGGF+LLAD Sbjct: 10 ITVEVE-EFEDLLPVMAEKLDVETFVSELCGGFKLLAD 46 >ref|NP_001239896.1| uncharacterized protein LOC100801586 [Glycine max] gi|255646980|gb|ACU23959.1| unknown [Glycine max] Length = 125 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 243 DSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 ++E+EDLLPVM +KLD ESFV+ELCGGF+LL+D Sbjct: 13 ETEFEDLLPVMAEKLDVESFVSELCGGFKLLSD 45 >ref|XP_007147336.1| hypothetical protein PHAVU_006G115300g [Phaseolus vulgaris] gi|561020559|gb|ESW19330.1| hypothetical protein PHAVU_006G115300g [Phaseolus vulgaris] Length = 125 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +3 Query: 243 DSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 + E+EDLLPVM +KLD E+FV+ELCGGF+LLAD Sbjct: 13 EEEFEDLLPVMAEKLDVETFVSELCGGFKLLAD 45 >ref|XP_002523300.1| ccd1, putative [Ricinus communis] gi|223537388|gb|EEF39016.1| ccd1, putative [Ricinus communis] Length = 125 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 252 YEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 YEDLLPVM +KLD +SFV+ELCGGFRLLAD Sbjct: 16 YEDLLPVMAEKLDVDSFVSELCGGFRLLAD 45 >ref|XP_002320212.1| calcium-binding family protein [Populus trichocarpa] gi|222860985|gb|EEE98527.1| calcium-binding family protein [Populus trichocarpa] Length = 125 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +3 Query: 207 MTSNPIHITMEPDSEYEDLLPVMVDKLDGESFVAELCGGFRLLAD 341 M I + EY+DLLPVM +KLD ++FV+ELCGGFRLLAD Sbjct: 1 MEKGQIGMKTATSGEYQDLLPVMAEKLDVKTFVSELCGGFRLLAD 45