BLASTX nr result
ID: Mentha25_contig00012961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00012961 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38978.1| hypothetical protein MIMGU_mgv1a018566mg, partial... 56 5e-06 >gb|EYU38978.1| hypothetical protein MIMGU_mgv1a018566mg, partial [Mimulus guttatus] Length = 939 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +3 Query: 45 VADMLKRGASFRWSEKSQSSFRSITKRFQEVTWK 146 VAD++K+ SFRWS+KS SSFRSI K+FQE TWK Sbjct: 906 VADIMKKSMSFRWSDKSHSSFRSIRKKFQEATWK 939