BLASTX nr result
ID: Mentha25_contig00012309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00012309 (749 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 67 7e-09 ref|XP_006430979.1| hypothetical protein CICLE_v10012020mg [Citr... 61 5e-07 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 67.0 bits (162), Expect = 7e-09 Identities = 51/179 (28%), Positives = 78/179 (43%), Gaps = 4/179 (2%) Frame = +1 Query: 46 GIGLDPVSGVFKIV--AVYHFSKIDKYGQDLFQGSKNRVHLYSLDTDSWTEVGCP--YSF 213 G G D ++ +K+V +F + ++ G ++V LYSL +DSW E+ P + + Sbjct: 157 GFGFDSITDDYKVVRFVTNYFDENEEEGG--LADWIHQVELYSLKSDSWKEISVPEAHPY 214 Query: 214 TSNSDSVYVGHKRYWTALTNRHPPVNGVFSFKDDVVSFNFRSNKFTVFPLPRYPPGKRGY 393 S + YV YW A N + +SF+ + KF+ PLP + Y Sbjct: 215 ASPLFNNYVNGSYYWQATGNSDYLI----------LSFDMANEKFSTLPLPTFGGSLAQY 264 Query: 394 VYDLLEYDGMLGAIGYSRNEDPTDYDIWVYKERSWRLARTFSFGCVEKALALKDDRFLF 570 LL+++G LGAI Y R D+WV R S VE+ L + LF Sbjct: 265 YLQLLDFNGSLGAIVYPREGTEKSIDLWVMNGSWTRQFSIESVSGVERPLGFWKNGELF 323 >ref|XP_006430979.1| hypothetical protein CICLE_v10012020mg [Citrus clementina] gi|557533036|gb|ESR44219.1| hypothetical protein CICLE_v10012020mg [Citrus clementina] Length = 366 Score = 60.8 bits (146), Expect = 5e-07 Identities = 50/169 (29%), Positives = 78/169 (46%), Gaps = 8/169 (4%) Frame = +1 Query: 7 KLKPTLIAEYHTC-----GIGLDPVSGVFKIVAVYHFSKIDKYGQDLFQGSKNRVHLYSL 171 ++ PT + C G G D SG FK+V + F K Y + V ++SL Sbjct: 131 RVLPTFYRDLSRCVPSLEGFGFDVGSGDFKLVKILAFGKPMNYTE---------VAVFSL 181 Query: 172 DTDSWTEV-GCPYSFTSNSDSVYVGHKRYWTALTNRHPPVNGVFSFKDDVVSFNFRSNKF 348 +SW + PY + + + SV+V +WTA N+ N D +++F+ +S +F Sbjct: 182 RVNSWRRIQDFPYFWVTGTCSVFVNGALHWTAALNQDADRN------DIIIAFDLKSEEF 235 Query: 349 TVFPLPRYPPGKRGYVYDLLEYDG--MLGAIGYSRNEDPTDYDIWVYKE 489 PLP G GY Y LLE G + + ++D +D+WV KE Sbjct: 236 YQVPLPPI-VGIEGY-YILLEALGGCLCLLCKFDDDDDDRPWDLWVMKE 282