BLASTX nr result
ID: Mentha25_contig00012096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00012096 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007047172.1| Ribosomal protein L25/Gln-tRNA synthetase, a... 55 8e-06 >ref|XP_007047172.1| Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain [Theobroma cacao] gi|508699433|gb|EOX91329.1| Ribosomal protein L25/Gln-tRNA synthetase, anti-codon-binding domain [Theobroma cacao] Length = 237 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 IEDRVSIHDVTVHPSLKLLSENESIPICKIKAMNTEYTE 119 I DRV +HDV VHPSLKLLS+NES+P+CKI A N E E Sbjct: 195 IGDRVLMHDVEVHPSLKLLSKNESMPMCKIVATNFENPE 233