BLASTX nr result
ID: Mentha25_contig00011691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011691 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46328.1| hypothetical protein MIMGU_mgv1a004285mg [Mimulus... 62 6e-08 >gb|EYU46328.1| hypothetical protein MIMGU_mgv1a004285mg [Mimulus guttatus] Length = 535 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/59 (57%), Positives = 39/59 (66%) Frame = -1 Query: 205 RSYGMWGXXXXXXQNPNLSSDAMRPPPSAFNKALGPRSNWKGKRVNKQIGGKPRMEQHQ 29 RS+G+W QNPN + AM+PP SAF K LGPRSNWKGKRVNK K R EQ + Sbjct: 41 RSFGIW-PPPPQFQNPNPNPGAMKPPSSAFKKPLGPRSNWKGKRVNKP-NDKRRNEQQK 97