BLASTX nr result
ID: Mentha25_contig00011680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011680 (659 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32464.1| hypothetical protein MIMGU_mgv1a022871mg [Mimulus... 70 4e-10 gb|EPS72287.1| hypothetical protein M569_02473, partial [Genlise... 59 1e-06 gb|EYU22934.1| hypothetical protein MIMGU_mgv1a014011mg [Mimulus... 57 5e-06 >gb|EYU32464.1| hypothetical protein MIMGU_mgv1a022871mg [Mimulus guttatus] Length = 202 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 136 NWIVGLAITVVIPFFTGKWTSFLRIKNEVDTAVQIVEDIAEAVEK 2 NW VG A+TVVIPFFT KWTS L++KNEV+TAV+ VE I +AVEK Sbjct: 65 NWAVGFAMTVVIPFFTHKWTSLLKLKNEVETAVEAVEGIVDAVEK 109 >gb|EPS72287.1| hypothetical protein M569_02473, partial [Genlisea aurea] Length = 124 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 133 WIVGLAITVVIPFFTGKWTSFLRIKNEVDTAVQIVEDIAEAVEK 2 WI+GL IT V+PF T KW S L KN +DT VQ VED+ E VEK Sbjct: 14 WILGLIITFVLPFVTHKWGSLLVYKNRIDTVVQAVEDVVETVEK 57 >gb|EYU22934.1| hypothetical protein MIMGU_mgv1a014011mg [Mimulus guttatus] Length = 203 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/46 (47%), Positives = 35/46 (76%) Frame = -2 Query: 139 INWIVGLAITVVIPFFTGKWTSFLRIKNEVDTAVQIVEDIAEAVEK 2 ++W++GL +++++PFFT KW +KN ++TAV+ VE I EAVEK Sbjct: 86 MSWVLGLVVSLILPFFTNKWGPLWVLKNRIETAVETVEHIVEAVEK 131