BLASTX nr result
ID: Mentha25_contig00011596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00011596 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23957.1| hypothetical protein MIMGU_mgv1a007515mg [Mimulus... 129 6e-28 ref|XP_002533876.1| zinc finger protein, putative [Ricinus commu... 127 2e-27 emb|CBI18269.3| unnamed protein product [Vitis vinifera] 126 3e-27 ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein ligase RNF16... 126 3e-27 ref|XP_006473184.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 125 8e-27 ref|XP_006434599.1| hypothetical protein CICLE_v10001161mg [Citr... 125 8e-27 ref|XP_006434598.1| hypothetical protein CICLE_v10001161mg [Citr... 125 8e-27 ref|XP_006434597.1| hypothetical protein CICLE_v10001161mg [Citr... 125 8e-27 gb|EXB57740.1| E3 ubiquitin-protein ligase [Morus notabilis] 124 1e-26 ref|XP_007224446.1| hypothetical protein PRUPE_ppa022081mg, part... 124 1e-26 ref|XP_007020001.1| Protease-associated RING/U-box zinc finger f... 123 2e-26 ref|XP_004300704.1| PREDICTED: E3 ubiquitin-protein ligase RNF16... 123 3e-26 ref|XP_006376277.1| protease-associated zinc finger family prote... 122 4e-26 ref|XP_007143638.1| hypothetical protein PHAVU_007G088600g [Phas... 122 7e-26 ref|XP_006361369.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 121 9e-26 ref|XP_004250405.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 121 9e-26 ref|XP_002325986.1| hypothetical protein POPTR_0019s11200g [Popu... 121 1e-25 ref|XP_003556191.2| PREDICTED: E3 ubiquitin-protein ligase RNF13... 120 2e-25 ref|XP_003536389.1| PREDICTED: E3 ubiquitin-protein ligase RNF13... 120 2e-25 ref|XP_006649457.1| PREDICTED: E3 ubiquitin-protein ligase RNF16... 119 3e-25 >gb|EYU23957.1| hypothetical protein MIMGU_mgv1a007515mg [Mimulus guttatus] Length = 404 Score = 129 bits (323), Expect = 6e-28 Identities = 54/59 (91%), Positives = 59/59 (100%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AVLEDNCTSQTCAICLEDY+VG+KLR+LPCRHKFHA+CVDTWLTSWRTFCPVCKRDA+T Sbjct: 224 AVLEDNCTSQTCAICLEDYDVGDKLRILPCRHKFHAMCVDTWLTSWRTFCPVCKRDART 282 >ref|XP_002533876.1| zinc finger protein, putative [Ricinus communis] gi|223526177|gb|EEF28507.1| zinc finger protein, putative [Ricinus communis] Length = 434 Score = 127 bits (319), Expect = 2e-27 Identities = 53/59 (89%), Positives = 59/59 (100%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AV+EDNCTSQTCAICLEDY+VGEKLR+LPCRHKFHA+CVD+WLTSWRTFCPVCKRDA+T Sbjct: 226 AVVEDNCTSQTCAICLEDYSVGEKLRILPCRHKFHALCVDSWLTSWRTFCPVCKRDART 284 >emb|CBI18269.3| unnamed protein product [Vitis vinifera] Length = 424 Score = 126 bits (317), Expect = 3e-27 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 385 VLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 VLEDNCTS+TCAICLEDYNVGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 209 VLEDNCTSRTCAICLEDYNVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 266 >ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Vitis vinifera] Length = 446 Score = 126 bits (317), Expect = 3e-27 Identities = 53/58 (91%), Positives = 57/58 (98%) Frame = -1 Query: 385 VLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 VLEDNCTS+TCAICLEDYNVGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 225 VLEDNCTSRTCAICLEDYNVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 282 >ref|XP_006473184.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Citrus sinensis] Length = 444 Score = 125 bits (313), Expect = 8e-27 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AV+EDNCTS+TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 221 AVVEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 279 >ref|XP_006434599.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] gi|557536721|gb|ESR47839.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] Length = 444 Score = 125 bits (313), Expect = 8e-27 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AV+EDNCTS+TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 221 AVVEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 279 >ref|XP_006434598.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] gi|557536720|gb|ESR47838.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] Length = 296 Score = 125 bits (313), Expect = 8e-27 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AV+EDNCTS+TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 73 AVVEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 131 >ref|XP_006434597.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] gi|557536719|gb|ESR47837.1| hypothetical protein CICLE_v10001161mg [Citrus clementina] Length = 370 Score = 125 bits (313), Expect = 8e-27 Identities = 52/59 (88%), Positives = 58/59 (98%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AV+EDNCTS+TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 147 AVVEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 205 >gb|EXB57740.1| E3 ubiquitin-protein ligase [Morus notabilis] Length = 445 Score = 124 bits (312), Expect = 1e-26 Identities = 53/59 (89%), Positives = 57/59 (96%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AVLEDNCTS TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 222 AVLEDNCTSITCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDART 280 >ref|XP_007224446.1| hypothetical protein PRUPE_ppa022081mg, partial [Prunus persica] gi|462421382|gb|EMJ25645.1| hypothetical protein PRUPE_ppa022081mg, partial [Prunus persica] Length = 349 Score = 124 bits (311), Expect = 1e-26 Identities = 52/58 (89%), Positives = 57/58 (98%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAK 215 AVLEDNCTS+TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+ Sbjct: 186 AVLEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDAR 243 >ref|XP_007020001.1| Protease-associated RING/U-box zinc finger family protein [Theobroma cacao] gi|508725329|gb|EOY17226.1| Protease-associated RING/U-box zinc finger family protein [Theobroma cacao] Length = 487 Score = 123 bits (309), Expect = 2e-26 Identities = 51/59 (86%), Positives = 57/59 (96%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AVLEDNCTS+TCAICLEDY +GEKLR+LPCRHKFHA CVD+WLT+WRTFCPVCKRDA+T Sbjct: 266 AVLEDNCTSRTCAICLEDYTMGEKLRILPCRHKFHAFCVDSWLTTWRTFCPVCKRDART 324 >ref|XP_004300704.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Fragaria vesca subsp. vesca] Length = 446 Score = 123 bits (308), Expect = 3e-26 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAK 215 AVLEDNCTS TCAICLEDY+VGEKLR+LPCRHKFHA CVD+WLTSWRTFCPVCKRDA+ Sbjct: 224 AVLEDNCTSVTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCKRDAR 281 >ref|XP_006376277.1| protease-associated zinc finger family protein [Populus trichocarpa] gi|550325553|gb|ERP54074.1| protease-associated zinc finger family protein [Populus trichocarpa] Length = 461 Score = 122 bits (307), Expect = 4e-26 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 +VLEDNCTS TCAICLEDY VGEKLR+LPCRHKFHA CVD+WLT+WRTFCPVCKRDA+T Sbjct: 229 SVLEDNCTSTTCAICLEDYTVGEKLRILPCRHKFHAFCVDSWLTTWRTFCPVCKRDART 287 >ref|XP_007143638.1| hypothetical protein PHAVU_007G088600g [Phaseolus vulgaris] gi|561016828|gb|ESW15632.1| hypothetical protein PHAVU_007G088600g [Phaseolus vulgaris] Length = 439 Score = 122 bits (305), Expect = 7e-26 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AVLEDNCTS+TCAICLEDY +GEK+R+LPC HKFHA+CVD+WLTSWRTFCPVCKRDA+T Sbjct: 221 AVLEDNCTSRTCAICLEDYCIGEKIRILPCCHKFHAICVDSWLTSWRTFCPVCKRDART 279 >ref|XP_006361369.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Solanum tuberosum] Length = 444 Score = 121 bits (304), Expect = 9e-26 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 +VLEDNCTS TCAICLEDY VG+KLR+LPCRHKFHA+CVD WLTSWRTFCPVCKRDA+T Sbjct: 223 SVLEDNCTSVTCAICLEDYIVGDKLRILPCRHKFHAMCVDAWLTSWRTFCPVCKRDART 281 >ref|XP_004250405.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Solanum lycopersicum] Length = 444 Score = 121 bits (304), Expect = 9e-26 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 +VLEDNCTS TCAICLEDY VG+KLR+LPCRHKFHA+CVD WLTSWRTFCPVCKRDA+T Sbjct: 223 SVLEDNCTSVTCAICLEDYIVGDKLRILPCRHKFHAMCVDAWLTSWRTFCPVCKRDART 281 >ref|XP_002325986.1| hypothetical protein POPTR_0019s11200g [Populus trichocarpa] gi|222862861|gb|EEF00368.1| hypothetical protein POPTR_0019s11200g [Populus trichocarpa] Length = 437 Score = 121 bits (303), Expect = 1e-25 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 + LEDNCTS TCAICLEDY VGEKLR+LPCRHKFHA CVD+WLT+WRTFCPVCKRDA+T Sbjct: 220 SALEDNCTSTTCAICLEDYTVGEKLRILPCRHKFHAFCVDSWLTTWRTFCPVCKRDART 278 >ref|XP_003556191.2| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Glycine max] Length = 510 Score = 120 bits (302), Expect = 2e-25 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 +VLEDNCTS+TCAICLEDY VGEKLR+LPC HKFHA CVD+WLTSWRTFCPVCKRDA+T Sbjct: 237 SVLEDNCTSRTCAICLEDYCVGEKLRILPCCHKFHAACVDSWLTSWRTFCPVCKRDART 295 >ref|XP_003536389.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Glycine max] Length = 469 Score = 120 bits (301), Expect = 2e-25 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 388 AVLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 AVLEDNCTS+TCAICLEDY VGEKLR+LPC HKFHA CVD+WLTSWRTFCPVCKRDA++ Sbjct: 222 AVLEDNCTSRTCAICLEDYCVGEKLRILPCCHKFHAACVDSWLTSWRTFCPVCKRDARS 280 >ref|XP_006649457.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X1 [Oryza brachyantha] gi|573923771|ref|XP_006649458.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X2 [Oryza brachyantha] Length = 534 Score = 119 bits (299), Expect = 3e-25 Identities = 51/58 (87%), Positives = 52/58 (89%) Frame = -1 Query: 385 VLEDNCTSQTCAICLEDYNVGEKLRVLPCRHKFHAVCVDTWLTSWRTFCPVCKRDAKT 212 V EDNCTS CAICLEDYNVGEKLRVLPCRHKFHA CVD WLT+WRTFCPVCKRDA T Sbjct: 226 VQEDNCTSSMCAICLEDYNVGEKLRVLPCRHKFHAACVDLWLTTWRTFCPVCKRDAST 283