BLASTX nr result
ID: Mentha25_contig00009818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00009818 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35359.1| hypothetical protein MIMGU_mgv1a003387mg [Mimulus... 64 2e-08 >gb|EYU35359.1| hypothetical protein MIMGU_mgv1a003387mg [Mimulus guttatus] Length = 588 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/43 (72%), Positives = 37/43 (86%), Gaps = 3/43 (6%) Frame = -2 Query: 349 ILQIV--INMKKWIIYNYQSGWKPIKVAVAEINPDS-GLAAAT 230 ILQI+ + MK+WI YNYQSGWKPIK+ +AE+NPDS GLAAAT Sbjct: 546 ILQILQMVTMKRWITYNYQSGWKPIKITLAEVNPDSEGLAAAT 588