BLASTX nr result
ID: Mentha25_contig00009691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00009691 (552 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD42935.1| ribosomal protein S14 [Luzula sylvatica] 58 1e-06 gb|ABD42934.1| ribosomal protein S14 [Juncus effusus] 58 1e-06 gb|EYU43419.1| hypothetical protein MIMGU_mgv1a003457mg [Mimulus... 57 3e-06 ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] 57 4e-06 dbj|BAD83430.2| ribosomal protein S14 (mitochondrion) [Nicotiana... 57 4e-06 ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoen... 56 7e-06 >gb|ABD42935.1| ribosomal protein S14 [Luzula sylvatica] Length = 100 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 89 RNIRDHKRRVLAAKYELRRKLYKALLQDP 3 RNIRDHKRR+LAAKYELRRKLYKAL QDP Sbjct: 5 RNIRDHKRRLLAAKYELRRKLYKALCQDP 33 >gb|ABD42934.1| ribosomal protein S14 [Juncus effusus] Length = 100 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 89 RNIRDHKRRVLAAKYELRRKLYKALLQDP 3 RNIRDHKRR+LAAKYELRRKLYKAL QDP Sbjct: 5 RNIRDHKRRLLAAKYELRRKLYKALCQDP 33 >gb|EYU43419.1| hypothetical protein MIMGU_mgv1a003457mg [Mimulus guttatus] Length = 584 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -2 Query: 428 MQKMAIFQRFSRTFRENSLLAKAMNNFTISGGDLMAYSQAKS 303 M+KM +FQRFSRTFR+N L K + FT+SGG L+AYS+AK+ Sbjct: 1 MRKMTVFQRFSRTFRDNPSLGKMLIVFTVSGGGLVAYSEAKA 42 >ref|YP_173367.1| ribosomal protein S14 [Nicotiana tabacum] Length = 119 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 89 RNIRDHKRRVLAAKYELRRKLYKALLQDP 3 RNIRDHKRR+LAAKYELRRKLYKAL +DP Sbjct: 5 RNIRDHKRRLLAAKYELRRKLYKALCKDP 33 >dbj|BAD83430.2| ribosomal protein S14 (mitochondrion) [Nicotiana tabacum] Length = 119 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 89 RNIRDHKRRVLAAKYELRRKLYKALLQDP 3 RNIRDHKRR+LAAKYELRRKLYKAL +DP Sbjct: 5 RNIRDHKRRLLAAKYELRRKLYKALCKDP 33 >ref|YP_005090361.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] gi|343478413|gb|AEM43901.1| ribosomal protein S14 (mitochondrion) [Phoenix dactylifera] Length = 107 Score = 55.8 bits (133), Expect = 7e-06 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 125 REKGPKTTPDRNRNIRDHKRRVLAAKYELRRKLYKALLQDP 3 REK K + RNIRDHKRR+LAAKYELRRKLYKA +DP Sbjct: 2 REKLSKMS--EKRNIRDHKRRLLAAKYELRRKLYKAFCKDP 40