BLASTX nr result
ID: Mentha25_contig00009674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00009674 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHJ90431.1| phytoene synthase [Pogostemon cablin] 61 1e-07 >gb|AHJ90431.1| phytoene synthase [Pogostemon cablin] Length = 439 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 167 MSVAMLWVVSPTSEVFSGVGFLEPVSNGNRILDAFRCNSRFKNVI 301 MSVA+LWVVSPTSE G GFL+ V +G+RILD+FR +R KNVI Sbjct: 1 MSVALLWVVSPTSEASYGTGFLDSVRDGSRILDSFRSIARCKNVI 45