BLASTX nr result
ID: Mentha25_contig00009279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00009279 (603 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38213.1| Cysteine-rich receptor-like protein kinase 10 [Mo... 57 4e-06 >gb|EXB38213.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis] Length = 367 Score = 57.0 bits (136), Expect = 4e-06 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = -3 Query: 601 LLCVQKNARERPTXXXXXXXXXXXXXXXALPSEPAFYFPS--ASDLSRIEDLESRESRKE 428 LLCVQ N +RPT +PSEPAF+ S ASD+S DL SR + Sbjct: 288 LLCVQVNVADRPTMNTVVLMLNSNSLSLPVPSEPAFFMHSRIASDMSLASDLNSRSDHSK 347 Query: 427 AEQSDHSSKSDVSFTELHPR 368 +E + +S ++ S TE +PR Sbjct: 348 SESGNQASVNEASITEFYPR 367