BLASTX nr result
ID: Mentha25_contig00008535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008535 (467 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24309.1| hypothetical protein MIMGU_mgv1a022401mg, partial... 59 5e-07 gb|EYU36437.1| hypothetical protein MIMGU_mgv1a005750mg [Mimulus... 59 9e-07 >gb|EYU24309.1| hypothetical protein MIMGU_mgv1a022401mg, partial [Mimulus guttatus] Length = 466 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 465 ISTNSLLVEYLRWRASRHPQSLPQQISSGV 376 ISTNSLLVEYLRWRASR+PQSLPQQISSG+ Sbjct: 375 ISTNSLLVEYLRWRASRNPQSLPQQISSGL 404 >gb|EYU36437.1| hypothetical protein MIMGU_mgv1a005750mg [Mimulus guttatus] Length = 472 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 465 ISTNSLLVEYLRWRASRHPQSLPQQISSGV 376 ISTNSLLVEYLRWRASR+PQSLPQ ISSGV Sbjct: 381 ISTNSLLVEYLRWRASRNPQSLPQHISSGV 410