BLASTX nr result
ID: Mentha25_contig00008294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008294 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus... 55 8e-06 >gb|EYU46488.1| hypothetical protein MIMGU_mgv1a008523mg [Mimulus guttatus] Length = 371 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = +1 Query: 1 FWEELLKVRSDEEKKITLLTKVAVNGNSGNSSRVQLASLQKVVSELIPKLECAERKTVEA 180 +W ELLK S ++ ITLL K+AVNGN R A +Q VVSEL+P+LECA+ V A Sbjct: 315 YWVELLKSHSGAQE-ITLLAKLAVNGNHNWLRR---APMQNVVSELLPRLECAQTNQVGA 370 Query: 181 C 183 C Sbjct: 371 C 371