BLASTX nr result
ID: Mentha25_contig00008242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008242 (891 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007289240.1| hypothetical protein MBM_01351 [Marssonina b... 99 2e-18 >ref|XP_007289240.1| hypothetical protein MBM_01351 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867631|gb|EKD20669.1| hypothetical protein MBM_01351 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 234 Score = 99.4 bits (246), Expect = 2e-18 Identities = 65/188 (34%), Positives = 93/188 (49%), Gaps = 16/188 (8%) Frame = +2 Query: 236 AKEETTNIEAKKAMLNTITRPKSSQKLQLPPIPSLKPLTLSDLAAELN----------DT 385 A+E ++A + R S +++ +PPI KPLT ++L L D Sbjct: 46 AQEAQDKLDATMGVFARFRRTTSLKEITIPPISRTKPLTFTNLFGALKKDPGISCLAVDE 105 Query: 386 SWTEKCPNYEFQKP---IRRKPV--PIQEFQSTDFHLNKSVNFDPNAPLTNTSIHARARK 550 + + +C + I+RKPV P+ F+ D FD AP N AR Sbjct: 106 NTSSECQGPVIRPSGEIIKRKPVTPPLSAFKVCDVP-----KFDVQAPRRNPDSVHLARS 160 Query: 551 VLKERYQSKFTF-GQDSTKDLIPRAYNVVWVDEEELDRKVLYDIIWVRQRYAQAKKNEPN 727 VLK RY +KF G + K + Y +W +EEL+RKV+ DIIWVR+RYAQA + EP+ Sbjct: 161 VLKHRYTTKFEMEGFEPAKGRLRSDYYFMWASDEELERKVMEDIIWVRERYAQAGREEPD 220 Query: 728 DQDIIWWY 751 D +I WY Sbjct: 221 DNAVIAWY 228