BLASTX nr result
ID: Mentha25_contig00008193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00008193 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45976.1| hypothetical protein MIMGU_mgv1a004451mg [Mimulus... 80 3e-13 >gb|EYU45976.1| hypothetical protein MIMGU_mgv1a004451mg [Mimulus guttatus] Length = 526 Score = 80.1 bits (196), Expect = 3e-13 Identities = 49/110 (44%), Positives = 66/110 (60%), Gaps = 7/110 (6%) Frame = +3 Query: 42 ARGLLISLNSAPKPHLLRTTGKASFHSKSRPASFHLCPCERAHLHRIYDGIR---RVRWG 212 +R LLISL SAPK H + + +A+F S LCPC+RAH IY G RV+ G Sbjct: 4 SRALLISLYSAPKTHP-QISPRATFLPNSG-LLLQLCPCQRAHFRPIYVGNGLSWRVKSG 61 Query: 213 RLRAEVKSEQYDVVESVPESIGLDQV----LPPEDDGGGSVDAIALPWWE 350 R+RA+VKSE D+ ES P+S+ +V + +DD G V + A+PWWE Sbjct: 62 RVRADVKSEPCDIAESPPDSVQFGKVFATSIVDDDDDDGDVTSAAVPWWE 111