BLASTX nr result
ID: Mentha25_contig00007421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00007421 (533 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26724.1| hypothetical protein MIMGU_mgv1a014687mg [Mimulus... 70 8e-14 gb|EPS71447.1| hypothetical protein M569_03316, partial [Genlise... 49 5e-07 ref|XP_007132452.1| hypothetical protein PHAVU_011G095400g [Phas... 46 9e-06 >gb|EYU26724.1| hypothetical protein MIMGU_mgv1a014687mg [Mimulus guttatus] Length = 181 Score = 70.5 bits (171), Expect(2) = 8e-14 Identities = 37/57 (64%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = +2 Query: 2 ELPSDGDRPAVASPSNCMAKIMGGPHQLFISQKDAITP-IANAKEKSAGSLTTARPL 169 ELPSD + +PSNCMAKIMGGPHQLF+S KDA P IANA+E S TTA+PL Sbjct: 75 ELPSDEPTKS-ENPSNCMAKIMGGPHQLFVSTKDAFAPVIANARESSGSLFTTAKPL 130 Score = 32.0 bits (71), Expect(2) = 8e-14 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 196 PREWGLAPSSYY 231 PREWGLAPSSYY Sbjct: 160 PREWGLAPSSYY 171 >gb|EPS71447.1| hypothetical protein M569_03316, partial [Genlisea aurea] Length = 180 Score = 48.5 bits (114), Expect(2) = 5e-07 Identities = 23/56 (41%), Positives = 36/56 (64%) Frame = +2 Query: 2 ELPSDGDRPAVASPSNCMAKIMGGPHQLFISQKDAITPIANAKEKSAGSLTTARPL 169 +LPSD P +S NCMAKIMGGP+QL++ +A P++ ++ AG ++P+ Sbjct: 77 DLPSDAAPPPPSS--NCMAKIMGGPYQLYVKASEASVPVSRT-QRRAGVFAVSKPM 129 Score = 30.8 bits (68), Expect(2) = 5e-07 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 196 PREWGLAPSSYY 231 P+EWGLAPSSYY Sbjct: 159 PKEWGLAPSSYY 170 >ref|XP_007132452.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris] gi|561005452|gb|ESW04446.1| hypothetical protein PHAVU_011G095400g [Phaseolus vulgaris] Length = 166 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = +2 Query: 2 ELPSDGDRPAVASPSNCMAKIMGGPHQLFISQKDAITPIANAKEKSAGSLTT 157 ELPSD NC+AK++GGP QL++S KD I+ I KE+++ +++T Sbjct: 71 ELPSD--------KGNCLAKVLGGPVQLYVSGKDQISEIVKGKEQNSYTIST 114 Score = 29.3 bits (64), Expect(2) = 9e-06 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +1 Query: 196 PREWGLAPSSYY 231 P EWGLAPSSYY Sbjct: 145 PPEWGLAPSSYY 156