BLASTX nr result
ID: Mentha25_contig00007040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00007040 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29726.1| hypothetical protein MIMGU_mgv1a003867mg [Mimulus... 63 4e-08 >gb|EYU29726.1| hypothetical protein MIMGU_mgv1a003867mg [Mimulus guttatus] Length = 559 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = -1 Query: 181 MPALAASRVLLLVGDAISSGKYFLFTR-VTPRYSSLRRFSCVSNENVKTLTLKSLGFRSE 5 MPALAA+RVLL V D +SSGK++ F+R V PRY S+R + V+NE+ + LTL +LGF+SE Sbjct: 1 MPALAATRVLLFVADTLSSGKFYGFSRVVAPRYGSVRFLTRVTNES-QPLTLATLGFKSE 59