BLASTX nr result
ID: Mentha25_contig00007015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00007015 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus... 59 9e-07 >gb|EYU45593.1| hypothetical protein MIMGU_mgv1a012297mg [Mimulus guttatus] Length = 254 Score = 58.5 bits (140), Expect = 9e-07 Identities = 40/98 (40%), Positives = 50/98 (51%), Gaps = 3/98 (3%) Frame = +3 Query: 33 NRDRGYGASDGRYSGHRSRSMSRSASPKVE---XXXXXXXXXXXXXXXXXXPQDEEMHRP 203 +R +GYGA D +S RSRS+SRS SP+ E P DE+ HR Sbjct: 160 SRGKGYGARDDYHSPRRSRSISRSVSPRNERNHRSREKPTRRSRSFSRSVSPLDEKNHRQ 219 Query: 204 SVRSPSPRENGRGGYGSRSQSPRRNSMSPVGRR*RSTS 317 RS +P+EN RS+SP+RNS SP R RS S Sbjct: 220 IRRSTNPKEN-----APRSRSPKRNSRSPSRSRSRSYS 252