BLASTX nr result
ID: Mentha25_contig00006883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006883 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35387.1| hypothetical protein MIMGU_mgv1a001660mg [Mimulus... 45 2e-09 >gb|EYU35387.1| hypothetical protein MIMGU_mgv1a001660mg [Mimulus guttatus] Length = 777 Score = 45.1 bits (105), Expect(3) = 2e-09 Identities = 26/45 (57%), Positives = 29/45 (64%), Gaps = 7/45 (15%) Frame = +2 Query: 167 SPSVSLHFSTAHNPFTLFSS-------RPNSIVGPSISFVPSAVA 280 +P +SLHFSTAH PF FSS R + G SISFVPSAVA Sbjct: 44 APPLSLHFSTAHYPFRAFSSSSAAAAARLKNGAGASISFVPSAVA 88 Score = 38.9 bits (89), Expect(3) = 2e-09 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = +1 Query: 343 AGNEGELSLSKLRLPQRLVDTLEKRGITE 429 A + EL ++KL+LP+RLV+TLEKRGI++ Sbjct: 129 AASVDELDMTKLKLPRRLVETLEKRGISQ 157 Score = 22.7 bits (47), Expect(3) = 2e-09 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 130 QPLSRELQKT 159 QP+SRELQKT Sbjct: 30 QPISRELQKT 39