BLASTX nr result
ID: Mentha25_contig00006687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006687 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23397.1| hypothetical protein MIMGU_mgv1a024506mg, partial... 69 7e-10 gb|EYU23403.1| hypothetical protein MIMGU_mgv1a005998mg [Mimulus... 65 1e-08 >gb|EYU23397.1| hypothetical protein MIMGU_mgv1a024506mg, partial [Mimulus guttatus] Length = 464 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/53 (52%), Positives = 45/53 (84%) Frame = +1 Query: 217 DNIVMATVPNGLTPEDDPNNPFTLMEALRNTMPENLTHLIERINTSNPNERVS 375 DNI++A++P+G +PEDDPN+ F L+E+LR++ P +T LIE+IN SNP++++S Sbjct: 65 DNIILASIPDGRSPEDDPNDTFKLLESLRHSTPGFVTELIEKINISNPDQKIS 117 >gb|EYU23403.1| hypothetical protein MIMGU_mgv1a005998mg [Mimulus guttatus] Length = 461 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/53 (50%), Positives = 41/53 (77%) Frame = +1 Query: 217 DNIVMATVPNGLTPEDDPNNPFTLMEALRNTMPENLTHLIERINTSNPNERVS 375 DNI++ ++P+G +PEDDPN+ L+E LR++MP + LIE IN SNP++R+S Sbjct: 62 DNIILVSIPDGRSPEDDPNDTIKLLETLRHSMPGFVADLIEEINGSNPDQRIS 114