BLASTX nr result
ID: Mentha25_contig00006647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00006647 (458 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44319.1| hypothetical protein MIMGU_mgv1a014081mg [Mimulus... 59 9e-07 >gb|EYU44319.1| hypothetical protein MIMGU_mgv1a014081mg [Mimulus guttatus] Length = 201 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/65 (47%), Positives = 37/65 (56%) Frame = -2 Query: 457 ENGFSEEVCDDFLIGVPYYWEEFSTLPVSVSEDSCASKGVSASAAYKTPTQETRESKMSS 278 ENGF EV DDFLIG PYYWEEF+ + V SKG S S A KTP + + + Sbjct: 77 ENGFPREVSDDFLIGFPYYWEEFAAVSV--------SKGFSCSDACKTPGPADHTTSVPN 128 Query: 277 EKSFD 263 +FD Sbjct: 129 MDNFD 133