BLASTX nr result
ID: Mentha25_contig00005736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00005736 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20721.1| hypothetical protein MIMGU_mgv1a009365mg [Mimulus... 87 2e-15 gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlise... 68 2e-09 >gb|EYU20721.1| hypothetical protein MIMGU_mgv1a009365mg [Mimulus guttatus] Length = 344 Score = 87.4 bits (215), Expect = 2e-15 Identities = 45/59 (76%), Positives = 46/59 (77%) Frame = -3 Query: 179 MEPNVEAVQPQFRSGISGPKPGGMGFVFDDIQGPISGPPETDGTSFTALLELPPPQAVE 3 MEP VEA QPQFRSGISGPK G M F D I G ISG PE D +SFTALLELPPPQAVE Sbjct: 1 MEPKVEASQPQFRSGISGPKLGEMDFGLDQIHGLISGLPEIDRSSFTALLELPPPQAVE 59 >gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlisea aurea] Length = 239 Score = 67.8 bits (164), Expect = 2e-09 Identities = 40/60 (66%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = -3 Query: 179 MEPNVEAVQPQFRSGISGPKPGG-MGFVFDDIQGPISGPPETDGTSFTALLELPPPQAVE 3 MEP V V+ QFRS PK G MGFV D+IQG IS PPET+ +SFTALLELPPP+AVE Sbjct: 1 MEPAV--VEAQFRSA---PKDGEEMGFVLDEIQGLISVPPETESSSFTALLELPPPKAVE 55