BLASTX nr result
ID: Mentha25_contig00005654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00005654 (529 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18988.1| hypothetical protein MIMGU_mgv1a002859mg [Mimulus... 77 3e-12 ref|XP_004486994.1| PREDICTED: telomere repeat-binding protein 5... 69 9e-10 ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5... 68 2e-09 ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5... 68 2e-09 ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citr... 68 2e-09 ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citr... 68 2e-09 ref|XP_006424851.1| hypothetical protein CICLE_v10027927mg [Citr... 68 2e-09 gb|EXC10679.1| Telomere repeat-binding protein 5 [Morus notabilis] 67 2e-09 ref|XP_002283389.2| PREDICTED: telomere repeat-binding protein 5... 67 3e-09 emb|CBI16113.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_007150334.1| hypothetical protein PHAVU_005G144900g [Phas... 67 3e-09 ref|XP_007016386.1| TRF-like 2, putative isoform 2 [Theobroma ca... 67 3e-09 ref|XP_007016385.1| TRF-like 2, putative isoform 1 [Theobroma ca... 67 3e-09 ref|XP_003597364.1| Telomeric repeat-binding protein [Medicago t... 67 3e-09 ref|XP_004145334.1| PREDICTED: telomere repeat-binding protein 5... 66 4e-09 ref|XP_002534561.1| conserved hypothetical protein [Ricinus comm... 66 6e-09 ref|XP_007208711.1| hypothetical protein PRUPE_ppa002403mg [Prun... 65 1e-08 gb|ADL36784.1| MYBR domain class transcription factor [Malus dom... 65 1e-08 ref|XP_006597267.1| PREDICTED: telomere repeat-binding protein 2... 62 8e-08 ref|XP_006595031.1| PREDICTED: telomere repeat-binding protein 5... 62 8e-08 >gb|EYU18988.1| hypothetical protein MIMGU_mgv1a002859mg [Mimulus guttatus] Length = 630 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLKSHPDTCLLL Sbjct: 595 PVPQELLDRVLTAHAYWSQQQAKQQLKSHPDTCLLL 630 >ref|XP_004486994.1| PREDICTED: telomere repeat-binding protein 5-like [Cicer arietinum] Length = 724 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/37 (86%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWS-QQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWS QQQ KQQ+K+HP+TCLLL Sbjct: 688 PVPQELLDRVLTAHAYWSQQQQTKQQIKNHPETCLLL 724 >ref|XP_006488345.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 [Citrus sinensis] Length = 701 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYW+QQQ KQQ K P+TCLLL Sbjct: 666 PVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 701 >ref|XP_006488343.1| PREDICTED: telomere repeat-binding protein 5-like isoform X1 [Citrus sinensis] gi|568870301|ref|XP_006488344.1| PREDICTED: telomere repeat-binding protein 5-like isoform X2 [Citrus sinensis] Length = 706 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYW+QQQ KQQ K P+TCLLL Sbjct: 671 PVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 706 >ref|XP_006424854.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|568870307|ref|XP_006488347.1| PREDICTED: telomere repeat-binding protein 5-like isoform X5 [Citrus sinensis] gi|557526788|gb|ESR38094.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 694 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYW+QQQ KQQ K P+TCLLL Sbjct: 659 PVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 694 >ref|XP_006424852.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|567864408|ref|XP_006424853.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|568870305|ref|XP_006488346.1| PREDICTED: telomere repeat-binding protein 5-like isoform X4 [Citrus sinensis] gi|557526786|gb|ESR38092.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|557526787|gb|ESR38093.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 699 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYW+QQQ KQQ K P+TCLLL Sbjct: 664 PVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 699 >ref|XP_006424851.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] gi|557526785|gb|ESR38091.1| hypothetical protein CICLE_v10027927mg [Citrus clementina] Length = 659 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYW+QQQ KQQ K P+TCLLL Sbjct: 624 PVPQELLDRVLTAHAYWTQQQAKQQFKQQPETCLLL 659 >gb|EXC10679.1| Telomere repeat-binding protein 5 [Morus notabilis] Length = 720 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLL 107 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLL Sbjct: 685 PVPQELLDRVLTAHAYWSQQQAKQQLKPLPETCLL 719 >ref|XP_002283389.2| PREDICTED: telomere repeat-binding protein 5-like [Vitis vinifera] Length = 696 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK +TCLLL Sbjct: 661 PVPQELLDRVLTAHAYWSQQQAKQQLKHQSETCLLL 696 >emb|CBI16113.3| unnamed protein product [Vitis vinifera] Length = 646 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK +TCLLL Sbjct: 611 PVPQELLDRVLTAHAYWSQQQAKQQLKHQSETCLLL 646 >ref|XP_007150334.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] gi|593699793|ref|XP_007150335.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] gi|593699795|ref|XP_007150336.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] gi|561023598|gb|ESW22328.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] gi|561023599|gb|ESW22329.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] gi|561023600|gb|ESW22330.1| hypothetical protein PHAVU_005G144900g [Phaseolus vulgaris] Length = 718 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK H CLLL Sbjct: 683 PVPQELLDRVLTAHAYWSQQQTKQQLKHHSKPCLLL 718 >ref|XP_007016386.1| TRF-like 2, putative isoform 2 [Theobroma cacao] gi|508786749|gb|EOY34005.1| TRF-like 2, putative isoform 2 [Theobroma cacao] Length = 517 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLK-SHPDTCLLL*N 116 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLLL N Sbjct: 462 PVPQELLDRVLTAHAYWSQQQAKQQLKPQQPETCLLLYN 500 >ref|XP_007016385.1| TRF-like 2, putative isoform 1 [Theobroma cacao] gi|508786748|gb|EOY34004.1| TRF-like 2, putative isoform 1 [Theobroma cacao] Length = 716 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLK-SHPDTCLLL*N 116 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLLL N Sbjct: 661 PVPQELLDRVLTAHAYWSQQQAKQQLKPQQPETCLLLYN 699 >ref|XP_003597364.1| Telomeric repeat-binding protein [Medicago truncatula] gi|355486412|gb|AES67615.1| Telomeric repeat-binding protein [Medicago truncatula] Length = 713 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQ--PKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ +QQLK HP+TCLLL Sbjct: 676 PVPQELLDRVLTAHAYWSQQQQTKQQQLKHHPETCLLL 713 >ref|XP_004145334.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] gi|449471933|ref|XP_004153447.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] gi|449515670|ref|XP_004164871.1| PREDICTED: telomere repeat-binding protein 5-like [Cucumis sativus] Length = 674 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWS+QQ K QLK P+TCLLL Sbjct: 639 PVPQELLDRVLTAHAYWSKQQAKYQLKRQPETCLLL 674 >ref|XP_002534561.1| conserved hypothetical protein [Ricinus communis] gi|223525029|gb|EEF27822.1| conserved hypothetical protein [Ricinus communis] Length = 688 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLK-SHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLLL Sbjct: 652 PVPQELLDRVLTAHAYWSQQQAKQQLKQQQPETCLLL 688 >ref|XP_007208711.1| hypothetical protein PRUPE_ppa002403mg [Prunus persica] gi|462404353|gb|EMJ09910.1| hypothetical protein PRUPE_ppa002403mg [Prunus persica] Length = 676 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLL+ Sbjct: 642 PVPQELLDRVLTAHAYWSQQQAKQQLK-QPETCLLV 676 >gb|ADL36784.1| MYBR domain class transcription factor [Malus domestica] Length = 680 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSHPDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK P+TCLL+ Sbjct: 646 PVPQELLDRVLTAHAYWSQQQAKQQLK-QPETCLLV 680 >ref|XP_006597267.1| PREDICTED: telomere repeat-binding protein 2-like [Glycine max] Length = 720 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/37 (83%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSH-PDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK H CLLL Sbjct: 684 PVPQELLDRVLTAHAYWSQQQTKQQLKHHSTKPCLLL 720 >ref|XP_006595031.1| PREDICTED: telomere repeat-binding protein 5-like isoform X3 [Glycine max] Length = 646 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/37 (83%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +3 Query: 3 PVPQELLDRVLTAHAYWSQQQPKQQLKSH-PDTCLLL 110 PVPQELLDRVLTAHAYWSQQQ KQQLK H CLLL Sbjct: 610 PVPQELLDRVLTAHAYWSQQQTKQQLKHHSTKPCLLL 646