BLASTX nr result
ID: Mentha25_contig00004956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004956 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71700.1| hypothetical protein M569_03058 [Genlisea aurea] 61 2e-07 >gb|EPS71700.1| hypothetical protein M569_03058 [Genlisea aurea] Length = 279 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +1 Query: 1 AAKENASSMARNGNVIYLPSSNNMLLGVNPGR 96 AAKENA++M+RNGNV+YLPS+NNMLLGVNPGR Sbjct: 248 AAKENAATMSRNGNVMYLPSTNNMLLGVNPGR 279