BLASTX nr result
ID: Mentha25_contig00004883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004883 (500 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23027.1| hypothetical protein MIMGU_mgv1a004452mg [Mimulus... 64 2e-08 >gb|EYU23027.1| hypothetical protein MIMGU_mgv1a004452mg [Mimulus guttatus] Length = 526 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = -1 Query: 491 GSFMGQEIAGRSMAPRPQGYPGFGLEDSTFASLNPNPQXXXXXXXXHPASNNFSATSGNP 312 GSF GQEI G SM PR QG GFG ++S FAS+NPNP +++NF++ SGNP Sbjct: 468 GSFAGQEIPG-SMPPRQQGLSGFGFDESAFASMNPNPHLGGLHHAH--SASNFTSASGNP 524 Query: 311 FG 306 FG Sbjct: 525 FG 526