BLASTX nr result
ID: Mentha25_contig00004452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004452 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus... 98 1e-18 >gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus guttatus] Length = 558 Score = 98.2 bits (243), Expect = 1e-18 Identities = 51/88 (57%), Positives = 66/88 (75%), Gaps = 3/88 (3%) Frame = -3 Query: 373 QSCPESSEL---PHLSPRSTLEVLPRISSAELCRSSNSCSPSNVENNVLLGAANSNIYSF 203 Q C E ++ PH SPRSTLE +PR+ S E+ +SN+C PSN++NN++L A N+N+YSF Sbjct: 474 QCCTEQTDSGANPHNSPRSTLEAVPRVISPEVNYNSNNC-PSNIQNNLVLKAVNNNLYSF 532 Query: 202 SCKGNIKLLMPKTPERKKLGFNVEQEIN 119 SCKGN+ LLMPK ERKK NV+QEIN Sbjct: 533 SCKGNLTLLMPKMEERKK--HNVQQEIN 558