BLASTX nr result
ID: Mentha25_contig00004421
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004421 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40528.1| hypothetical protein MIMGU_mgv1a003462mg [Mimulus... 87 3e-15 ref|XP_007163058.1| hypothetical protein PHAVU_001G202600g [Phas... 87 4e-15 ref|XP_007201723.1| hypothetical protein PRUPE_ppa003344mg [Prun... 86 7e-15 gb|ABG46343.1| transport inhibitor response 1 [Gossypium hirsutum] 85 2e-14 ref|XP_004309692.1| PREDICTED: protein TRANSPORT INHIBITOR RESPO... 82 1e-13 gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus not... 81 2e-13 ref|XP_002321035.1| TRANSPORT INHIBITOR RESPONSE 1 family protei... 81 2e-13 ref|XP_006290792.1| hypothetical protein CARUB_v10016894mg [Caps... 80 4e-13 ref|XP_006290791.1| hypothetical protein CARUB_v10016894mg [Caps... 80 4e-13 gb|AFS44506.1| auxin receptor 1, partial [Fragaria x ananassa] 80 4e-13 ref|XP_007050790.1| F-box/RNI-like superfamily protein isoform 1... 80 5e-13 gb|AFP19451.1| transport inhibitor response 1 [Camellia sinensis] 79 6e-13 ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabido... 79 8e-13 gb|ADL70210.1| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADL70208.1| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADL70207.1| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADB92045.2| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADB92044.2| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADB92043.2| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 gb|ADB92042.1| transport inhibitor response 1 [Arabidopsis thali... 79 8e-13 >gb|EYU40528.1| hypothetical protein MIMGU_mgv1a003462mg [Mimulus guttatus] Length = 583 Score = 87.0 bits (214), Expect = 3e-15 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKD 135 VEVIDERGHP SRPE+CPVEKLYIYRTV G RVD PDF+WTMEK+ Sbjct: 532 VEVIDERGHPGSRPESCPVEKLYIYRTVGGQRVDTPDFVWTMEKE 576 >ref|XP_007163058.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris] gi|319428659|gb|ADV56682.1| F-box/leucine rich repeat protein [Phaseolus vulgaris] gi|561036522|gb|ESW35052.1| hypothetical protein PHAVU_001G202600g [Phaseolus vulgaris] Length = 591 Score = 86.7 bits (213), Expect = 4e-15 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGGSHDVFLSNGAVE 177 VEVIDERG P SRP+NCPVEKLYIYRT+ GPR+DMP F+WTME D + LS+ AVE Sbjct: 536 VEVIDERGPPDSRPDNCPVEKLYIYRTIAGPRLDMPGFVWTMEDDS---SLGLSDHAVE 591 >ref|XP_007201723.1| hypothetical protein PRUPE_ppa003344mg [Prunus persica] gi|462397123|gb|EMJ02922.1| hypothetical protein PRUPE_ppa003344mg [Prunus persica] Length = 584 Score = 85.9 bits (211), Expect = 7e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKD 135 VEVIDERGHP SRPE+CPVEKLYIYR+V GPR DMP F+WTM++D Sbjct: 534 VEVIDERGHPESRPESCPVEKLYIYRSVAGPRFDMPGFVWTMDED 578 >gb|ABG46343.1| transport inhibitor response 1 [Gossypium hirsutum] Length = 586 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG 141 VEVIDERG P SRPENCPV+KLYIYR++ GPR DMP F+WTM++D G Sbjct: 536 VEVIDERGPPDSRPENCPVDKLYIYRSIAGPRFDMPPFVWTMDEDSG 582 >ref|XP_004309692.1| PREDICTED: protein TRANSPORT INHIBITOR RESPONSE 1-like [Fragaria vesca subsp. vesca] Length = 584 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEK 132 VEVIDERGHP RPE+CPVEKLYIYR+V GPR DMP FIWTM++ Sbjct: 534 VEVIDERGHPELRPESCPVEKLYIYRSVAGPRFDMPGFIWTMDE 577 >gb|EXC34697.1| Protein TRANSPORT INHIBITOR RESPONSE 1 [Morus notabilis] Length = 582 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGGS 144 VEVIDERG P +RPE+CPVEKLYIYR+V GPR DMP F+WTM++D + Sbjct: 531 VEVIDERGPPDTRPESCPVEKLYIYRSVAGPRFDMPGFVWTMDEDSSA 578 >ref|XP_002321035.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa] gi|222861808|gb|EEE99350.1| TRANSPORT INHIBITOR RESPONSE 1 family protein [Populus trichocarpa] Length = 584 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGGS 144 VEVIDERG P RPE+CPVEKLYIYRT+ GPR DMP F+WTM++D S Sbjct: 534 VEVIDERGPPDLRPESCPVEKLYIYRTIAGPRFDMPGFVWTMDEDSVS 581 >ref|XP_006290792.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] gi|482559499|gb|EOA23690.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] Length = 594 Score = 80.1 bits (196), Expect = 4e-13 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S ++ +NG Sbjct: 535 VEVIDERGSPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSREIITTNG 593 >ref|XP_006290791.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] gi|482559498|gb|EOA23689.1| hypothetical protein CARUB_v10016894mg [Capsella rubella] Length = 437 Score = 80.1 bits (196), Expect = 4e-13 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S ++ +NG Sbjct: 378 VEVIDERGSPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSREIITTNG 436 >gb|AFS44506.1| auxin receptor 1, partial [Fragaria x ananassa] Length = 579 Score = 80.1 bits (196), Expect = 4e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKD 135 VEVIDERGHP RPE+CPVE LYIYR+V GPR DMP FIWTM+++ Sbjct: 531 VEVIDERGHPELRPESCPVENLYIYRSVAGPRFDMPGFIWTMDEN 575 >ref|XP_007050790.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|590718325|ref|XP_007050791.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508703051|gb|EOX94947.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508703052|gb|EOX94948.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 587 Score = 79.7 bits (195), Expect = 5e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKD 135 VEVIDERG P SRPE+CPVEKLYIYR+V GPR DMP F+WTM+ + Sbjct: 536 VEVIDERGPPDSRPESCPVEKLYIYRSVAGPRFDMPPFVWTMDDE 580 >gb|AFP19451.1| transport inhibitor response 1 [Camellia sinensis] Length = 581 Score = 79.3 bits (194), Expect = 6e-13 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKD 135 VEVIDERG P SRP +CPV+KLY+YRTV GPR+DMPDF+W M+++ Sbjct: 531 VEVIDERGPPDSRPASCPVDKLYVYRTVAGPRLDMPDFVWMMDEE 575 >ref|NP_567135.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana] gi|68053009|sp|Q570C0.2|TIR1_ARATH RecName: Full=Protein TRANSPORT INHIBITOR RESPONSE 1; AltName: Full=Weak ethylene-insensitive protein 1 gi|146387658|pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure gi|146387660|pdb|2P1N|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387663|pdb|2P1N|E Chain E, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase gi|146387666|pdb|2P1O|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387669|pdb|2P1P|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|146387671|pdb|2P1Q|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase gi|185177934|pdb|3C6N|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|185177936|pdb|3C6O|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-Substrate Interactions In Auxin Perception And Signaling gi|185177938|pdb|3C6P|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein- Substrate Interactions In Auxin Perception And Signaling gi|2352492|gb|AAB69175.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|2352494|gb|AAB69176.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|7573427|emb|CAB87743.1| transport inhibitor response 1 (TIR1) [Arabidopsis thaliana] gi|25054937|gb|AAN71945.1| putative transport inhibitor response TIR1, AtFBL1 protein [Arabidopsis thaliana] gi|332646898|gb|AEE80419.1| protein TRANSPORT INHIBITOR RESPONSE 1 [Arabidopsis thaliana] Length = 594 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 535 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 593 >gb|ADL70210.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 261 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 202 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 260 >gb|ADL70208.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 247 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 188 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 246 >gb|ADL70207.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307833|gb|ADL70211.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 230 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 171 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 229 >gb|ADB92045.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|296593120|gb|ADB92046.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307819|gb|ADL70204.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307823|gb|ADL70206.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307835|gb|ADL70212.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307837|gb|ADL70213.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307839|gb|ADL70214.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307841|gb|ADL70215.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307843|gb|ADL70216.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 248 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 189 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 247 >gb|ADB92044.2| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307829|gb|ADL70209.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 249 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 190 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 248 >gb|ADB92043.2| transport inhibitor response 1 [Arabidopsis thaliana] Length = 250 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 191 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 249 >gb|ADB92042.1| transport inhibitor response 1 [Arabidopsis thaliana] gi|304307821|gb|ADL70205.1| transport inhibitor response 1 [Arabidopsis thaliana] Length = 246 Score = 79.0 bits (193), Expect = 8e-13 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = +1 Query: 1 VEVIDERGHPSSRPENCPVEKLYIYRTVTGPRVDMPDFIWTMEKDGG---SHDVFLSNG 168 VEVIDERG P SRPE+CPVE+++IYRTV GPR DMP F+W M++D S + +NG Sbjct: 187 VEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNG 245