BLASTX nr result
ID: Mentha25_contig00004150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004150 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173937.1| PREDICTED: ubiquilin-2-like, partial [Cucumi... 72 6e-11 ref|XP_004144885.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucum... 72 6e-11 ref|XP_004144884.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucum... 72 6e-11 ref|XP_006384838.1| ubiquitin family protein [Populus trichocarp... 71 1e-10 ref|XP_006379369.1| hypothetical protein POPTR_0009s16750g [Popu... 71 1e-10 ref|XP_006379368.1| hypothetical protein POPTR_0009s16750g [Popu... 71 1e-10 gb|EXC31549.1| hypothetical protein L484_006581 [Morus notabilis] 70 4e-10 ref|XP_002282473.2| PREDICTED: ubiquilin-1-like [Vitis vinifera] 70 4e-10 emb|CBI37752.3| unnamed protein product [Vitis vinifera] 70 4e-10 tpg|DAA43181.1| TPA: hypothetical protein ZEAMMB73_616463 [Zea m... 68 1e-09 tpg|DAA43180.1| TPA: hypothetical protein ZEAMMB73_616463 [Zea m... 68 1e-09 ref|XP_002465921.1| hypothetical protein SORBIDRAFT_01g048260 [S... 68 1e-09 ref|NP_001169509.1| uncharacterized protein LOC100383383 [Zea ma... 68 1e-09 ref|XP_007041622.1| Ubiquitin family protein isoform 3 [Theobrom... 68 1e-09 ref|XP_007041620.1| Ubiquitin family protein isoform 1 [Theobrom... 68 1e-09 emb|CAN59899.1| hypothetical protein VITISV_002886 [Vitis vinifera] 68 1e-09 ref|XP_004985838.1| PREDICTED: ubiquilin-like [Setaria italica] 67 2e-09 ref|XP_003629155.1| Ubiquilin-1 [Medicago truncatula] gi|3555231... 67 2e-09 gb|EYU38030.1| hypothetical protein MIMGU_mgv1a004076mg [Mimulus... 67 3e-09 ref|XP_006599297.1| PREDICTED: ubiquitin domain-containing prote... 67 3e-09 >ref|XP_004173937.1| PREDICTED: ubiquilin-2-like, partial [Cucumis sativus] Length = 215 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGNLGQ Sbjct: 180 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNLGQ 215 >ref|XP_004144885.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucumis sativus] gi|449473220|ref|XP_004153821.1| PREDICTED: ubiquilin-2-like isoform 2 [Cucumis sativus] Length = 546 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGNLGQ Sbjct: 511 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNLGQ 546 >ref|XP_004144884.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucumis sativus] gi|449473217|ref|XP_004153820.1| PREDICTED: ubiquilin-2-like isoform 1 [Cucumis sativus] Length = 551 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGNLGQ Sbjct: 516 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNLGQ 551 >ref|XP_006384838.1| ubiquitin family protein [Populus trichocarpa] gi|550341606|gb|ERP62635.1| ubiquitin family protein [Populus trichocarpa] Length = 567 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR T+GNVHAAVERLLGNLGQ Sbjct: 532 LQEMGFFDTQENIRALRATAGNVHAAVERLLGNLGQ 567 >ref|XP_006379369.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] gi|550331879|gb|ERP57166.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] Length = 561 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR T+GNVHAAVERLLGNLGQ Sbjct: 526 LQEMGFFDTQENIRALRATAGNVHAAVERLLGNLGQ 561 >ref|XP_006379368.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] gi|550331878|gb|ERP57165.1| hypothetical protein POPTR_0009s16750g [Populus trichocarpa] Length = 558 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR T+GNVHAAVERLLGNLGQ Sbjct: 523 LQEMGFFDTQENIRALRATAGNVHAAVERLLGNLGQ 558 >gb|EXC31549.1| hypothetical protein L484_006581 [Morus notabilis] Length = 553 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGN GQ Sbjct: 518 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNHGQ 553 >ref|XP_002282473.2| PREDICTED: ubiquilin-1-like [Vitis vinifera] Length = 558 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGN GQ Sbjct: 523 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNPGQ 558 >emb|CBI37752.3| unnamed protein product [Vitis vinifera] Length = 291 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR TSGNVHAAVERLLGN GQ Sbjct: 256 LQEMGFFDTQENIRALRATSGNVHAAVERLLGNPGQ 291 >tpg|DAA43181.1| TPA: hypothetical protein ZEAMMB73_616463 [Zea mays] Length = 536 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL T+GNVHAAVERLLGN+GQ Sbjct: 501 LQEMGFFDTQENIRALAATAGNVHAAVERLLGNMGQ 536 >tpg|DAA43180.1| TPA: hypothetical protein ZEAMMB73_616463 [Zea mays] Length = 529 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL T+GNVHAAVERLLGN+GQ Sbjct: 494 LQEMGFFDTQENIRALAATAGNVHAAVERLLGNMGQ 529 >ref|XP_002465921.1| hypothetical protein SORBIDRAFT_01g048260 [Sorghum bicolor] gi|241919775|gb|EER92919.1| hypothetical protein SORBIDRAFT_01g048260 [Sorghum bicolor] Length = 538 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL T+GNVHAAVERLLGN+GQ Sbjct: 503 LQEMGFFDTQENIRALAATAGNVHAAVERLLGNMGQ 538 >ref|NP_001169509.1| uncharacterized protein LOC100383383 [Zea mays] gi|224029753|gb|ACN33952.1| unknown [Zea mays] Length = 452 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL T+GNVHAAVERLLGN+GQ Sbjct: 417 LQEMGFFDTQENIRALAATAGNVHAAVERLLGNMGQ 452 >ref|XP_007041622.1| Ubiquitin family protein isoform 3 [Theobroma cacao] gi|508705557|gb|EOX97453.1| Ubiquitin family protein isoform 3 [Theobroma cacao] Length = 467 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGF+DTQENIRALR T+GNVHAAVERLLGN GQ Sbjct: 432 LQEMGFYDTQENIRALRATAGNVHAAVERLLGNSGQ 467 >ref|XP_007041620.1| Ubiquitin family protein isoform 1 [Theobroma cacao] gi|508705555|gb|EOX97451.1| Ubiquitin family protein isoform 1 [Theobroma cacao] Length = 624 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGF+DTQENIRALR T+GNVHAAVERLLGN GQ Sbjct: 589 LQEMGFYDTQENIRALRATAGNVHAAVERLLGNSGQ 624 >emb|CAN59899.1| hypothetical protein VITISV_002886 [Vitis vinifera] Length = 566 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRALR T GNVHAAVERLLGN GQ Sbjct: 531 LQEMGFFDTQENIRALRATXGNVHAAVERLLGNPGQ 566 >ref|XP_004985838.1| PREDICTED: ubiquilin-like [Setaria italica] Length = 536 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQEN+RAL T+GNVHAAVERLLGNLGQ Sbjct: 501 LQEMGFFDTQENLRALIATAGNVHAAVERLLGNLGQ 536 >ref|XP_003629155.1| Ubiquilin-1 [Medicago truncatula] gi|355523177|gb|AET03631.1| Ubiquilin-1 [Medicago truncatula] Length = 539 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL TSGNVHAAVERLLGN GQ Sbjct: 504 LQEMGFFDTQENIRALIATSGNVHAAVERLLGNTGQ 539 >gb|EYU38030.1| hypothetical protein MIMGU_mgv1a004076mg [Mimulus guttatus] Length = 545 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL TSGNVHAAVERLLGN GQ Sbjct: 510 LQEMGFFDTQENIRALLATSGNVHAAVERLLGNPGQ 545 >ref|XP_006599297.1| PREDICTED: ubiquitin domain-containing protein DSK2b-like isoform X3 [Glycine max] Length = 523 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 3 LQEMGFFDTQENIRALRVTSGNVHAAVERLLGNLGQ 110 LQEMGFFDTQENIRAL TSGNVHAAVERLLGN GQ Sbjct: 488 LQEMGFFDTQENIRALIATSGNVHAAVERLLGNSGQ 523