BLASTX nr result
ID: Mentha25_contig00004109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004109 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42254.1| hypothetical protein MIMGU_mgv1a016016mg [Mimulus... 81 1e-13 gb|EYU42253.1| hypothetical protein MIMGU_mgv1a016016mg [Mimulus... 81 1e-13 gb|EYU23249.1| hypothetical protein MIMGU_mgv11b013406mg [Mimulu... 81 1e-13 ref|XP_002512183.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002267950.1| PREDICTED: uncharacterized protein LOC100254... 72 6e-11 emb|CAN66725.1| hypothetical protein VITISV_022332 [Vitis vinifera] 72 6e-11 ref|XP_007218593.1| hypothetical protein PRUPE_ppa013312mg [Prun... 70 3e-10 ref|XP_006369468.1| hypothetical protein POPTR_0001s23720g [Popu... 69 7e-10 ref|XP_007149099.1| hypothetical protein PHAVU_005G041100g [Phas... 68 1e-09 ref|XP_003546859.1| PREDICTED: uncharacterized protein LOC100777... 68 2e-09 gb|EXB77330.1| hypothetical protein L484_010156 [Morus notabilis] 67 3e-09 ref|XP_004488458.1| PREDICTED: uncharacterized protein LOC101497... 67 3e-09 ref|XP_006482809.1| PREDICTED: uncharacterized protein LOC102624... 67 3e-09 ref|XP_006439019.1| hypothetical protein CICLE_v10033063mg [Citr... 66 6e-09 ref|XP_006660953.1| PREDICTED: uncharacterized protein LOC102718... 65 7e-09 ref|XP_004135903.1| PREDICTED: uncharacterized protein LOC101220... 65 7e-09 ref|XP_007052618.1| Ecotropic viral integration site 5 protein [... 65 1e-08 gb|EEC85027.1| hypothetical protein OsI_32328 [Oryza sativa Indi... 64 2e-08 gb|EAZ45608.1| hypothetical protein OsJ_30275 [Oryza sativa Japo... 64 2e-08 ref|NP_001063883.1| Os09g0553800 [Oryza sativa Japonica Group] g... 64 2e-08 >gb|EYU42254.1| hypothetical protein MIMGU_mgv1a016016mg [Mimulus guttatus] Length = 115 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 STMAEDPQVR LLS TADVW+PV+TATSDERRNFTS+ G++SL GK E Sbjct: 65 STMAEDPQVRTLLSNTADVWIPVVTATSDERRNFTSVVGDESLAGSGKGPE 115 >gb|EYU42253.1| hypothetical protein MIMGU_mgv1a016016mg [Mimulus guttatus] Length = 137 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 STMAEDPQVR LLS TADVW+PV+TATSDERRNFTS+ G++SL GK E Sbjct: 87 STMAEDPQVRTLLSNTADVWIPVVTATSDERRNFTSVVGDESLAGSGKGPE 137 >gb|EYU23249.1| hypothetical protein MIMGU_mgv11b013406mg [Mimulus guttatus] Length = 137 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 STMAEDPQVR LLS TADVW+PV+TATSDERRNFTS+ G++SL GK E Sbjct: 87 STMAEDPQVRTLLSNTADVWIPVVTATSDERRNFTSVVGDESLAGSGKGPE 137 >ref|XP_002512183.1| conserved hypothetical protein [Ricinus communis] gi|223548727|gb|EEF50217.1| conserved hypothetical protein [Ricinus communis] Length = 131 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTS 317 S MA DPQV++LLS TADVWMPVITAT+DERRNFT+ G+D+ EK +TS Sbjct: 81 SAMAADPQVQSLLSGTADVWMPVITATADERRNFTASIGDDTFEEKAETS 130 >ref|XP_002267950.1| PREDICTED: uncharacterized protein LOC100254452 [Vitis vinifera] gi|297741213|emb|CBI32164.3| unnamed protein product [Vitis vinifera] Length = 122 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSL 338 STMAEDP+VR+LLS+TADVWMPVITATSDERRNFT+ +D+L Sbjct: 80 STMAEDPEVRSLLSSTADVWMPVITATSDERRNFTAPVEDDNL 122 >emb|CAN66725.1| hypothetical protein VITISV_022332 [Vitis vinifera] Length = 119 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSL 338 STMAEDP+VR+LLS+TADVWMPVITATSDERRNFT+ +D+L Sbjct: 77 STMAEDPEVRSLLSSTADVWMPVITATSDERRNFTAPVEDDNL 119 >ref|XP_007218593.1| hypothetical protein PRUPE_ppa013312mg [Prunus persica] gi|462415055|gb|EMJ19792.1| hypothetical protein PRUPE_ppa013312mg [Prunus persica] Length = 130 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKT 320 S MA DPQV++LLS TADVWMPVITA +DERRNFTS +DS KGK+ Sbjct: 80 SAMASDPQVKSLLSGTADVWMPVITANADERRNFTSSIADDSPEAKGKS 128 >ref|XP_006369468.1| hypothetical protein POPTR_0001s23720g [Populus trichocarpa] gi|550348017|gb|ERP66037.1| hypothetical protein POPTR_0001s23720g [Populus trichocarpa] Length = 130 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGK 323 S +A DPQV++LLS TADVWMPVITA +DERRNFT+ G D EKG+ Sbjct: 80 SALASDPQVQSLLSDTADVWMPVITANADERRNFTASVGNDKSEEKGE 127 >ref|XP_007149099.1| hypothetical protein PHAVU_005G041100g [Phaseolus vulgaris] gi|543177554|gb|AGV54798.1| hypothetical protein [Phaseolus vulgaris] gi|561022363|gb|ESW21093.1| hypothetical protein PHAVU_005G041100g [Phaseolus vulgaris] Length = 130 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSL 338 ++MA DPQV++LLS TADVWMPVITATS+ERRNFT+ GE++L Sbjct: 80 TSMASDPQVQSLLSDTADVWMPVITATSEERRNFTAATGENTL 122 >ref|XP_003546859.1| PREDICTED: uncharacterized protein LOC100777666 [Glycine max] Length = 130 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSL 338 S+MA DPQV++LLS TADVWMPVITATS+ERRNFT+ G+ +L Sbjct: 80 SSMASDPQVQSLLSDTADVWMPVITATSEERRNFTAATGDSTL 122 >gb|EXB77330.1| hypothetical protein L484_010156 [Morus notabilis] Length = 130 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 S +A DPQV++LLS TA+VWMPVITAT+DERRNFT+ +D L +GK S+ Sbjct: 80 SAVAADPQVQSLLSGTANVWMPVITATADERRNFTASIEDDKLQVQGKASD 130 >ref|XP_004488458.1| PREDICTED: uncharacterized protein LOC101497563 [Cicer arietinum] Length = 130 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/51 (60%), Positives = 42/51 (82%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 STMA DPQV++LLS+TAD+WMPVITATS+ERRNFT+ G+++ + S+ Sbjct: 80 STMAADPQVQSLLSSTADLWMPVITATSEERRNFTASPGDNTTQTDAENSK 130 >ref|XP_006482809.1| PREDICTED: uncharacterized protein LOC102624232 [Citrus sinensis] Length = 134 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGK 323 S +A DPQV++LLS TADVWMPVITAT+DERRNFT G+D+ K K Sbjct: 80 SAIAADPQVQSLLSGTADVWMPVITATADERRNFTGSIGDDTTEVKDK 127 >ref|XP_006439019.1| hypothetical protein CICLE_v10033063mg [Citrus clementina] gi|557541215|gb|ESR52259.1| hypothetical protein CICLE_v10033063mg [Citrus clementina] Length = 130 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKT 320 S +A DPQV++LLS TADVWMPVITAT+DERRNFT G+D+ K ++ Sbjct: 80 SAIAADPQVQSLLSGTADVWMPVITATADERRNFTGSIGDDTTEVKDRS 128 >ref|XP_006660953.1| PREDICTED: uncharacterized protein LOC102718768 [Oryza brachyantha] Length = 130 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 S MA DP+V++LLS+TAD+WMPVITA++DERR F +GE S E+ K+ + Sbjct: 80 SAMASDPEVKSLLSSTADIWMPVITASADERRGFVGTSGESSKEEQEKSEQ 130 >ref|XP_004135903.1| PREDICTED: uncharacterized protein LOC101220647 [Cucumis sativus] gi|449524950|ref|XP_004169484.1| PREDICTED: uncharacterized protein LOC101227237 [Cucumis sativus] Length = 129 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDS 341 S MA DPQV++LLS TAD+WMPVITA++DERRNFT GE+S Sbjct: 80 SAMAADPQVQSLLSDTADIWMPVITASADERRNFTPSVGENS 121 >ref|XP_007052618.1| Ecotropic viral integration site 5 protein [Theobroma cacao] gi|508704879|gb|EOX96775.1| Ecotropic viral integration site 5 protein [Theobroma cacao] Length = 150 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/53 (60%), Positives = 38/53 (71%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSEKL 308 S MA DP V++LLS TADVWMPVITA +DERRNFT+ D L +K + E L Sbjct: 96 SAMAADPHVQSLLSGTADVWMPVITANADERRNFTASMPHDKLQDKPQGDENL 148 >gb|EEC85027.1| hypothetical protein OsI_32328 [Oryza sativa Indica Group] Length = 130 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 S MA DP+V++LLSTTAD+WMPVITA++DERR F +GE + E+ + + Sbjct: 80 SAMASDPEVKSLLSTTADIWMPVITASADERRGFAGTSGESNQEEQESSKQ 130 >gb|EAZ45608.1| hypothetical protein OsJ_30275 [Oryza sativa Japonica Group] Length = 130 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 S MA DP+V++LLSTTAD+WMPVITA++DERR F +GE + E+ + + Sbjct: 80 SAMASDPEVKSLLSTTADIWMPVITASADERRGFAGTSGESNQEEQESSKQ 130 >ref|NP_001063883.1| Os09g0553800 [Oryza sativa Japonica Group] gi|113632116|dbj|BAF25797.1| Os09g0553800, partial [Oryza sativa Japonica Group] Length = 73 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = -3 Query: 466 STMAEDPQVRALLSTTADVWMPVITATSDERRNFTSIAGEDSLGEKGKTSE 314 S MA DP+V++LLSTTAD+WMPVITA++DERR F +GE + E+ + + Sbjct: 23 SAMASDPEVKSLLSTTADIWMPVITASADERRGFAGTSGESNQEEQESSKQ 73