BLASTX nr result
ID: Mentha25_contig00004091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00004091 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35661.1| hypothetical protein MIMGU_mgv1a015217mg [Mimulus... 68 1e-09 ref|XP_006428529.1| hypothetical protein CICLE_v10012804mg [Citr... 64 2e-08 ref|XP_006428528.1| hypothetical protein CICLE_v10012804mg [Citr... 64 2e-08 ref|XP_002321821.2| cytochrome b5 domain-containing family prote... 64 2e-08 ref|XP_002523648.1| steroid binding protein, putative [Ricinus c... 64 2e-08 ref|XP_006836203.1| hypothetical protein AMTR_s00101p00080290 [A... 63 4e-08 gb|EPS68475.1| hypothetical protein M569_06296, partial [Genlise... 63 5e-08 ref|XP_006647586.1| PREDICTED: membrane steroid-binding protein ... 62 8e-08 ref|XP_003558029.1| PREDICTED: membrane steroid-binding protein ... 61 1e-07 ref|XP_006661925.1| PREDICTED: membrane steroid-binding protein ... 60 3e-07 ref|XP_007152294.1| hypothetical protein PHAVU_004G117500g [Phas... 60 3e-07 ref|XP_004982690.1| PREDICTED: membrane steroid-binding protein ... 60 3e-07 gb|EMT07748.1| Membrane steroid-binding protein 2 [Aegilops taus... 60 3e-07 gb|EMS60465.1| Membrane steroid-binding protein 2 [Triticum urartu] 60 3e-07 gb|EMS59327.1| Membrane steroid-binding protein 1 [Triticum urartu] 60 3e-07 ref|NP_001064993.1| Os10g0502600 [Oryza sativa Japonica Group] g... 60 3e-07 tpg|DAA49403.1| TPA: hypothetical protein ZEAMMB73_911071 [Zea m... 60 3e-07 gb|AFK46196.1| unknown [Medicago truncatula] 60 3e-07 ref|XP_003574153.1| PREDICTED: membrane steroid-binding protein ... 60 3e-07 ref|XP_003574152.1| PREDICTED: membrane steroid-binding protein ... 60 3e-07 >gb|EYU35661.1| hypothetical protein MIMGU_mgv1a015217mg [Mimulus guttatus] Length = 164 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/94 (45%), Positives = 45/94 (47%), Gaps = 42/94 (44%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFD-------------------------------- 85 RMFYGPGGPYALFAGRDASRALALMSF+ Sbjct: 71 RMFYGPGGPYALFAGRDASRALALMSFEPTDLTGNVEGLSESELEVLQDWEYKFMEKYVK 130 Query: 86 ----------PKEAVKVGEASKLDEDKSEEHKAE 157 PKE GEASKL EDKSEE + E Sbjct: 131 VGQLVSKTSAPKETENEGEASKLHEDKSEETRTE 164 >ref|XP_006428529.1| hypothetical protein CICLE_v10012804mg [Citrus clementina] gi|568877550|ref|XP_006491794.1| PREDICTED: membrane steroid-binding protein 2-like [Citrus sinensis] gi|557530586|gb|ESR41769.1| hypothetical protein CICLE_v10012804mg [Citrus clementina] Length = 203 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYA+FAGRDASRALALMSFDP++ Sbjct: 116 RMFYGPGGPYAMFAGRDASRALALMSFDPQD 146 >ref|XP_006428528.1| hypothetical protein CICLE_v10012804mg [Citrus clementina] gi|557530585|gb|ESR41768.1| hypothetical protein CICLE_v10012804mg [Citrus clementina] Length = 195 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYA+FAGRDASRALALMSFDP++ Sbjct: 108 RMFYGPGGPYAMFAGRDASRALALMSFDPQD 138 >ref|XP_002321821.2| cytochrome b5 domain-containing family protein [Populus trichocarpa] gi|550322745|gb|EEF05948.2| cytochrome b5 domain-containing family protein [Populus trichocarpa] Length = 197 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAGR+ASRALALMSFDP++ Sbjct: 115 RMFYGPGGPYALFAGREASRALALMSFDPRD 145 >ref|XP_002523648.1| steroid binding protein, putative [Ricinus communis] gi|223537100|gb|EEF38734.1| steroid binding protein, putative [Ricinus communis] Length = 197 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKEAVKVGEASKLDEDKSE 142 RMFYGPGGPYA FAGRDASRALAL+SFDPK+ G L E + E Sbjct: 106 RMFYGPGGPYAKFAGRDASRALALLSFDPKDL--TGNLEGLSESELE 150 >ref|XP_006836203.1| hypothetical protein AMTR_s00101p00080290 [Amborella trichopoda] gi|548838703|gb|ERM99056.1| hypothetical protein AMTR_s00101p00080290 [Amborella trichopoda] Length = 200 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGG YALFAGRDASRALALMSFDPK+ Sbjct: 104 RMFYGPGGHYALFAGRDASRALALMSFDPKD 134 >gb|EPS68475.1| hypothetical protein M569_06296, partial [Genlisea aurea] Length = 163 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKEAVKVGEASKLDEDKSE 142 RMFYGPGGPYA FAGRDASRALALMSFDP + G L + + E Sbjct: 96 RMFYGPGGPYASFAGRDASRALALMSFDPNDL--TGNVEGLSDSEME 140 >ref|XP_006647586.1| PREDICTED: membrane steroid-binding protein 2-like [Oryza brachyantha] Length = 347 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAGRDASRALA MSFDP + Sbjct: 109 RMFYGPGGPYALFAGRDASRALAKMSFDPDD 139 >ref|XP_003558029.1| PREDICTED: membrane steroid-binding protein 2-like [Brachypodium distachyon] Length = 205 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKEAVKVGEASKLDEDKSE 142 R+FYGP GPY+LFAGRDASRALALMSFDP + G+ L D+ E Sbjct: 118 RLFYGPQGPYSLFAGRDASRALALMSFDPNDL--TGDLEGLSPDEME 162 >ref|XP_006661925.1| PREDICTED: membrane steroid-binding protein 1-like [Oryza brachyantha] Length = 268 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 155 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 185 >ref|XP_007152294.1| hypothetical protein PHAVU_004G117500g [Phaseolus vulgaris] gi|561025603|gb|ESW24288.1| hypothetical protein PHAVU_004G117500g [Phaseolus vulgaris] Length = 213 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSFD K+ Sbjct: 103 RMFYGPGGPYALFAGKDASRALAKMSFDEKD 133 >ref|XP_004982690.1| PREDICTED: membrane steroid-binding protein 2-like [Setaria italica] Length = 220 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 103 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 133 >gb|EMT07748.1| Membrane steroid-binding protein 2 [Aegilops tauschii] Length = 225 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 103 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 133 >gb|EMS60465.1| Membrane steroid-binding protein 2 [Triticum urartu] Length = 186 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 66 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 96 >gb|EMS59327.1| Membrane steroid-binding protein 1 [Triticum urartu] Length = 204 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 109 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 139 >ref|NP_001064993.1| Os10g0502600 [Oryza sativa Japonica Group] gi|10140799|gb|AAG13629.1|AC078840_20 putative steroid membrane binding protein [Oryza sativa Japonica Group] gi|110289351|gb|ABB47845.2| Membrane steroid binding protein 1, putative, expressed [Oryza sativa Japonica Group] gi|113639602|dbj|BAF26907.1| Os10g0502600 [Oryza sativa Japonica Group] gi|215697473|dbj|BAG91467.1| unnamed protein product [Oryza sativa Japonica Group] gi|215740702|dbj|BAG97358.1| unnamed protein product [Oryza sativa Japonica Group] Length = 232 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 106 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 136 >tpg|DAA49403.1| TPA: hypothetical protein ZEAMMB73_911071 [Zea mays] Length = 114 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 5 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 35 >gb|AFK46196.1| unknown [Medicago truncatula] Length = 220 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSFD K+ Sbjct: 106 RMFYGPGGPYALFAGKDASRALAKMSFDEKD 136 >ref|XP_003574153.1| PREDICTED: membrane steroid-binding protein 2-like [Brachypodium distachyon] Length = 211 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 103 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 133 >ref|XP_003574152.1| PREDICTED: membrane steroid-binding protein 1-like [Brachypodium distachyon] Length = 250 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 2 RMFYGPGGPYALFAGRDASRALALMSFDPKE 94 RMFYGPGGPYALFAG+DASRALA MSF+P++ Sbjct: 153 RMFYGPGGPYALFAGKDASRALAKMSFEPQD 183