BLASTX nr result
ID: Mentha25_contig00003481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00003481 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007158522.1| hypothetical protein PHAVU_002G159200g [Phas... 55 8e-06 >ref|XP_007158522.1| hypothetical protein PHAVU_002G159200g [Phaseolus vulgaris] gi|561031937|gb|ESW30516.1| hypothetical protein PHAVU_002G159200g [Phaseolus vulgaris] Length = 285 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/56 (48%), Positives = 38/56 (67%) Frame = +3 Query: 3 FLRSPHTMLRLLLKAYNISIRPMLNPFLAYYIKLLSIAACILSSALKILYYLAKIF 170 FLRSPH +L +LK YNI I L+P L YIKL S +LSSA+ ++++++K F Sbjct: 228 FLRSPHVILTWILKVYNIFIASWLHPLLDGYIKLWSFFVRLLSSAITLVFFISKTF 283