BLASTX nr result
ID: Mentha25_contig00002861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002861 (616 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF74563.1|AF208544_1 heat stress transcription factor A3 [So... 57 4e-06 ref|NP_001234854.1| heat stress transcription factor A3 [Solanum... 57 4e-06 ref|XP_006341165.1| PREDICTED: heat stress transcription factor ... 57 6e-06 >gb|AAF74563.1|AF208544_1 heat stress transcription factor A3 [Solanum peruvianum] Length = 508 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 5/57 (8%) Frame = -3 Query: 614 AETRHKQLMSFLARMLNNPTFSTHFKR-----GIASPRTVRRFVKHEPHEPDLCNSS 459 AE R KQ++SFLA++L NPTF ++ I SPRT+R+FVKH+ H PD SS Sbjct: 247 AEQRQKQMVSFLAKVLQNPTFLARVRQMKEQGEITSPRTMRKFVKHQSHGPDGVGSS 303 >ref|NP_001234854.1| heat stress transcription factor A3 [Solanum lycopersicum] gi|264666931|gb|ACY71071.1| heat stress transcription factor A3 [Solanum lycopersicum] Length = 506 Score = 57.0 bits (136), Expect = 4e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 5/57 (8%) Frame = -3 Query: 614 AETRHKQLMSFLARMLNNPTFSTHFKR-----GIASPRTVRRFVKHEPHEPDLCNSS 459 AE R KQ++SFLA++L NPTF ++ I SPRT+R+FVKH+ H PD SS Sbjct: 245 AEQRQKQMVSFLAKVLQNPTFLARVRQMKEQGEITSPRTMRKFVKHQSHGPDGVGSS 301 >ref|XP_006341165.1| PREDICTED: heat stress transcription factor A-3-like isoform X1 [Solanum tuberosum] gi|565348330|ref|XP_006341166.1| PREDICTED: heat stress transcription factor A-3-like isoform X2 [Solanum tuberosum] gi|565348332|ref|XP_006341167.1| PREDICTED: heat stress transcription factor A-3-like isoform X3 [Solanum tuberosum] gi|565348334|ref|XP_006341168.1| PREDICTED: heat stress transcription factor A-3-like isoform X4 [Solanum tuberosum] Length = 501 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 7/81 (8%) Frame = -3 Query: 614 AETRHKQLMSFLARMLNNPTFSTHFKR-----GIASPRTVRRFVKHEPHEPDLCNSS--E 456 AE R KQ++SFLA++L NPTF ++ I PRT+R+FVK++PH PD SS E Sbjct: 239 AEQRQKQMVSFLAKVLQNPTFLARVRQMKEQGEITCPRTMRKFVKYQPHGPDGVGSSSME 298 Query: 455 NQPREELGTVDEFVRCPENGD 393 Q + + C E+ D Sbjct: 299 GQIVKVRSDFQDLAACFESPD 319