BLASTX nr result
ID: Mentha25_contig00002816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002816 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27540.1| hypothetical protein MIMGU_mgv1a013311mg [Mimulus... 92 1e-16 >gb|EYU27540.1| hypothetical protein MIMGU_mgv1a013311mg [Mimulus guttatus] Length = 224 Score = 91.7 bits (226), Expect = 1e-16 Identities = 50/88 (56%), Positives = 62/88 (70%) Frame = +3 Query: 111 MIIHSAPLHHRILPSCAKSSTSGGHFRRKCELFRRQNNFSLSSDSGSQYLRIRGAREHLP 290 MII S PLHHR L SC+++S G +FRR ELF N S S+ + + L + +++ L Sbjct: 1 MIISSGPLHHRTL-SCSRTSICGDNFRRDYELFPIPRNLSSSNSAAYKSLHLPVSQKPLF 59 Query: 291 SPLAVGSNVSEDTDDMYDDLFEKYGKVV 374 S AVGSNVSEDTDDMYDDLF+KYGKVV Sbjct: 60 SRTAVGSNVSEDTDDMYDDLFKKYGKVV 87