BLASTX nr result
ID: Mentha25_contig00002712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002712 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB33878.1| ERF transcription factor 07 [Coffea arabica] 60 3e-07 gb|EPS59592.1| ethylene response factor 3 [Genlisea aurea] 57 2e-06 >gb|AHB33878.1| ERF transcription factor 07 [Coffea arabica] Length = 222 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 2/50 (4%) Frame = -1 Query: 300 NAVGVGYGRGGAMQSESDTSSVVDENNFDGQDGKR--GLDLDLNMPPPLE 157 N VG G G GGA+ S+SDTSSVVD+N DG + KR GLDLDLN PPP+E Sbjct: 173 NVVGRGRG-GGAVHSDSDTSSVVDDNISDGDNMKRGGGLDLDLNFPPPVE 221 >gb|EPS59592.1| ethylene response factor 3 [Genlisea aurea] Length = 222 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 1/39 (2%) Frame = -1 Query: 276 RGGAMQSESDTSSVVDENNF-DGQDGKRGLDLDLNMPPP 163 RGGA+ S+SDTSSVVDEN++ DG D K+ L+LDLN+PPP Sbjct: 180 RGGALISDSDTSSVVDENHYYDGSDPKKALNLDLNLPPP 218