BLASTX nr result
ID: Mentha25_contig00002661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002661 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41916.1| hypothetical protein MIMGU_mgv1a005306mg [Mimulus... 110 2e-22 gb|AAT11172.1| putative short-chain acyl-CoA oxidase [Tropaeolum... 107 2e-21 ref|XP_002532113.1| acyl-CoA dehydrogenase, putative [Ricinus co... 106 3e-21 ref|XP_004302546.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 105 5e-21 ref|XP_004137705.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 104 1e-20 ref|XP_003632582.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 103 2e-20 ref|XP_002264086.2| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 103 2e-20 ref|XP_006481057.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 103 3e-20 gb|EPS73556.1| hypothetical protein M569_01198, partial [Genlise... 101 9e-20 ref|XP_007026667.1| Acyl-CoA oxidase 4 [Theobroma cacao] gi|5087... 101 9e-20 gb|EXB99423.1| Acyl-coenzyme A oxidase 4 [Morus notabilis] 100 3e-19 ref|NP_190752.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana... 100 3e-19 pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From A... 100 3e-19 dbj|BAD95143.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] 100 3e-19 ref|XP_002877827.1| acyl-CoA oxidase 4 [Arabidopsis lyrata subsp... 99 5e-19 ref|XP_007207462.1| hypothetical protein PRUPE_ppa005916mg [Prun... 99 6e-19 ref|XP_002308225.1| ACYL-COA oxidase 4 family protein [Populus t... 99 8e-19 ref|XP_006655020.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 97 2e-18 ref|XP_006576136.1| PREDICTED: acyl-CoA oxidase isoform X2 [Glyc... 97 2e-18 ref|XP_006576135.1| PREDICTED: acyl-CoA oxidase isoform X1 [Glyc... 97 2e-18 >gb|EYU41916.1| hypothetical protein MIMGU_mgv1a005306mg [Mimulus guttatus] Length = 489 Score = 110 bits (275), Expect = 2e-22 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGI+SFKP SSNRSRL Sbjct: 434 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGIASFKPAASSNRSRL 489 >gb|AAT11172.1| putative short-chain acyl-CoA oxidase [Tropaeolum majus] Length = 440 Score = 107 bits (267), Expect = 2e-21 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGILSDFLVAKAFCDLEPIYTYEGT+DINTLVTGRE+TG++SFKP TSS RSRL Sbjct: 385 GGNGILSDFLVAKAFCDLEPIYTYEGTFDINTLVTGREVTGLASFKPATSSQRSRL 440 >ref|XP_002532113.1| acyl-CoA dehydrogenase, putative [Ricinus communis] gi|223528216|gb|EEF30275.1| acyl-CoA dehydrogenase, putative [Ricinus communis] Length = 440 Score = 106 bits (265), Expect = 3e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TGI+SFKP SNRSRL Sbjct: 385 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGIASFKPAALSNRSRL 440 >ref|XP_004302546.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Fragaria vesca subsp. vesca] Length = 435 Score = 105 bits (263), Expect = 5e-21 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGILSDFLVAKAFCDLEPIYTYEGTYDIN+LVTGREITG++SFKP SS RSRL Sbjct: 380 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINSLVTGREITGVASFKPAPSSKRSRL 435 >ref|XP_004137705.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Cucumis sativus] gi|449483509|ref|XP_004156611.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Cucumis sativus] Length = 440 Score = 104 bits (259), Expect = 1e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITG++SFKP + RSRL Sbjct: 385 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGVASFKPAALAKRSRL 440 >ref|XP_003632582.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like isoform 2 [Vitis vinifera] Length = 439 Score = 103 bits (257), Expect = 2e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGI+SFKP + RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGIASFKPAALNRRSRL 439 >ref|XP_002264086.2| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like isoform 1 [Vitis vinifera] gi|296083170|emb|CBI22806.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 103 bits (257), Expect = 2e-20 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGI+SFKP + RSRL Sbjct: 391 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGIASFKPAALNRRSRL 446 >ref|XP_006481057.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Citrus sinensis] Length = 439 Score = 103 bits (256), Expect = 3e-20 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGILSDFLVAKAFCD+EPIYTYEGTYDINTLVTGRE+TGI+SFKP + RSRL Sbjct: 384 GGNGILSDFLVAKAFCDIEPIYTYEGTYDINTLVTGREVTGIASFKPVALATRSRL 439 >gb|EPS73556.1| hypothetical protein M569_01198, partial [Genlisea aurea] Length = 431 Score = 101 bits (252), Expect = 9e-20 Identities = 51/58 (87%), Positives = 54/58 (93%), Gaps = 2/58 (3%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTS--SNRSRL 170 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGI+SFKP +S S +SRL Sbjct: 374 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGIASFKPSSSGFSAKSRL 431 >ref|XP_007026667.1| Acyl-CoA oxidase 4 [Theobroma cacao] gi|508715272|gb|EOY07169.1| Acyl-CoA oxidase 4 [Theobroma cacao] Length = 477 Score = 101 bits (252), Expect = 9e-20 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDIN+LVTGREITG +SFKP S RSRL Sbjct: 422 GGNGILADFLVAKAFCDLEPIYTYEGTYDINSLVTGREITGFASFKPAALSQRSRL 477 >gb|EXB99423.1| Acyl-coenzyme A oxidase 4 [Morus notabilis] Length = 439 Score = 100 bits (248), Expect = 3e-19 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTY+IN+LV GRE+TG +SFKP SS RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYEINSLVAGREVTGFASFKPSASSQRSRL 439 >ref|NP_190752.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana] gi|62286630|sp|Q96329.1|ACOX4_ARATH RecName: Full=Acyl-coenzyme A oxidase 4, peroxisomal; Short=AOX 4; AltName: Full=G6p; AltName: Full=Short-chain acyl-CoA oxidase; Short=AtCX4; Short=AtG6; Short=SAOX gi|114794822|pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794823|pdb|2IX5|B Chain B, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794824|pdb|2IX5|C Chain C, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|114794825|pdb|2IX5|D Chain D, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa gi|1657621|gb|AAB18129.1| G6p [Arabidopsis thaliana] gi|3068711|gb|AAC14411.1| putative acyl-coA dehydrogenase [Arabidopsis thaliana] gi|5478795|dbj|BAA82478.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] gi|20453143|gb|AAM19813.1| At3g51840/AtG6 [Arabidopsis thaliana] gi|21593380|gb|AAM65329.1| acyl-coA dehydrogenase [Arabidopsis thaliana] gi|21928035|gb|AAM78046.1| At3g51840/AtG6 [Arabidopsis thaliana] gi|332645330|gb|AEE78851.1| acyl-coenzyme A oxidase 4 [Arabidopsis thaliana] Length = 436 Score = 100 bits (248), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TGI+SFKP T RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGIASFKPAT---RSRL 436 >pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794827|pdb|2IX6|B Chain B, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794828|pdb|2IX6|C Chain C, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794829|pdb|2IX6|D Chain D, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794830|pdb|2IX6|E Chain E, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 gi|114794831|pdb|2IX6|F Chain F, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Score = 100 bits (248), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TGI+SFKP T RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGIASFKPAT---RSRL 436 >dbj|BAD95143.1| Short-chain acyl CoA oxidase [Arabidopsis thaliana] Length = 185 Score = 100 bits (248), Expect = 3e-19 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TGI+SFKP T RSRL Sbjct: 133 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGIASFKPAT---RSRL 185 >ref|XP_002877827.1| acyl-CoA oxidase 4 [Arabidopsis lyrata subsp. lyrata] gi|297323665|gb|EFH54086.1| acyl-CoA oxidase 4 [Arabidopsis lyrata subsp. lyrata] Length = 436 Score = 99.4 bits (246), Expect = 5e-19 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TG++SFKP T RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGLASFKPAT---RSRL 436 >ref|XP_007207462.1| hypothetical protein PRUPE_ppa005916mg [Prunus persica] gi|402715756|gb|AFQ93696.1| acyl-CoA oxidase 4 [Prunus persica] gi|462403104|gb|EMJ08661.1| hypothetical protein PRUPE_ppa005916mg [Prunus persica] Length = 437 Score = 99.0 bits (245), Expect = 6e-19 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAF DLEPIYT+EGTYDIN LVTGREITGI+SFKP SS RSRL Sbjct: 382 GGNGILADFLVAKAFGDLEPIYTFEGTYDINALVTGREITGIASFKPAASSQRSRL 437 >ref|XP_002308225.1| ACYL-COA oxidase 4 family protein [Populus trichocarpa] gi|222854201|gb|EEE91748.1| ACYL-COA oxidase 4 family protein [Populus trichocarpa] Length = 436 Score = 98.6 bits (244), Expect = 8e-19 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKA CDLEPIYTYEGTYDIN+L+TGREITG++SFKP S RSR+ Sbjct: 381 GGNGILADFLVAKALCDLEPIYTYEGTYDINSLITGREITGLASFKPAMLSKRSRM 436 >ref|XP_006655020.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal-like [Oryza brachyantha] Length = 441 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/56 (83%), Positives = 54/56 (96%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPI++YEGTYDIN+LVTGREITGI+SFKP TS+ +SRL Sbjct: 387 GGNGILADFLVAKAFCDLEPIFSYEGTYDINSLVTGREITGIASFKPATST-KSRL 441 >ref|XP_006576136.1| PREDICTED: acyl-CoA oxidase isoform X2 [Glycine max] Length = 368 Score = 97.1 bits (240), Expect = 2e-18 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TG +SFKP + RSRL Sbjct: 315 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGFASFKP--VAQRSRL 368 >ref|XP_006576135.1| PREDICTED: acyl-CoA oxidase isoform X1 [Glycine max] Length = 437 Score = 97.1 bits (240), Expect = 2e-18 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 3 GGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTGREITGISSFKPPTSSNRSRL 170 GGNGIL+DFLVAKAFCDLEPIYTYEGTYDINTLVTGRE+TG +SFKP + RSRL Sbjct: 384 GGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGFASFKP--VAQRSRL 437