BLASTX nr result
ID: Mentha25_contig00002525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00002525 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU75701.1| chitin synthase activator [Blumeria graminis f. ... 61 1e-07 gb|EPQ63645.1| chitin synthase III [Blumeria graminis f. sp. tri... 61 1e-07 >emb|CCU75701.1| chitin synthase activator [Blumeria graminis f. sp. hordei DH14] Length = 862 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 199 VTSPKTSGPKKTGPATFEEMGIPAANKEGEC 291 V SP T GPKKTGPATFEEMGIPAANKEG+C Sbjct: 818 VASPTTPGPKKTGPATFEEMGIPAANKEGDC 848 >gb|EPQ63645.1| chitin synthase III [Blumeria graminis f. sp. tritici 96224] Length = 862 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 199 VTSPKTSGPKKTGPATFEEMGIPAANKEGEC 291 V SP T GPKKTGPATFEEMGIPAANKEG+C Sbjct: 818 VVSPTTPGPKKTGPATFEEMGIPAANKEGDC 848