BLASTX nr result
ID: Mentha25_contig00001862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00001862 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29040.1| hypothetical protein MIMGU_mgv1a015025mg [Mimulus... 59 9e-07 >gb|EYU29040.1| hypothetical protein MIMGU_mgv1a015025mg [Mimulus guttatus] Length = 170 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 346 PYKVEFVTEEVMGRDGKPAKFLAHLREDEFEFI 248 PYK+EFV +++ GRDGKP KF AHLREDEFEF+ Sbjct: 137 PYKIEFVADDLPGRDGKPVKFSAHLREDEFEFL 169