BLASTX nr result
ID: Mentha25_contig00001140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00001140 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28019.1| Cell division protein FtsY-like protein [Morus no... 82 1e-13 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 82 1e-13 ref|XP_007051904.1| Signal recognition particle receptor protein... 79 5e-13 ref|XP_007051903.1| Signal recognition particle receptor protein... 79 5e-13 gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] 79 5e-13 gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum... 79 5e-13 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 79 5e-13 ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citr... 79 7e-13 ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolo... 79 7e-13 ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolo... 79 7e-13 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 79 7e-13 ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago ... 79 7e-13 ref|XP_002320775.1| signal recognition particle receptor family ... 79 7e-13 gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlise... 79 9e-13 ref|XP_002961591.1| hypothetical protein SELMODRAFT_77470 [Selag... 78 1e-12 ref|XP_006645363.1| PREDICTED: cell division protein FtsY homolo... 78 1e-12 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 78 1e-12 ref|XP_004971321.1| PREDICTED: cell division protein FtsY homolo... 78 1e-12 ref|XP_004971320.1| PREDICTED: cell division protein FtsY homolo... 78 1e-12 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 78 1e-12 >gb|EXC28019.1| Cell division protein FtsY-like protein [Morus notabilis] Length = 371 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 333 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 371 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 324 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 362 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 327 CVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 365 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 407 CVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 445 >gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] Length = 370 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 332 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 370 >gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum urartu] Length = 336 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 298 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 336 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 317 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 355 >ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|567905284|ref|XP_006445130.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|568875898|ref|XP_006491027.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547391|gb|ESR58369.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|557547392|gb|ESR58370.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] Length = 372 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 334 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cicer arietinum] Length = 365 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 327 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolog [Brachypodium distachyon] Length = 360 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVG+GEGVEDLQPFDAEAFV AIFP Sbjct: 322 CVVSVVDELGIPVKFVGIGEGVEDLQPFDAEAFVEAIFP 360 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 334 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago truncatula] gi|355521650|gb|AET02104.1| Signal recognition 54 kDa protein [Medicago truncatula] Length = 402 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 364 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >ref|XP_002320775.1| signal recognition particle receptor family protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| signal recognition particle receptor family protein [Populus trichocarpa] Length = 365 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 327 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlisea aurea] Length = 330 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKFVGVGEGVEDLQPFD +AFVNAIFP Sbjct: 292 CVVSVVDELGIPVKFVGVGEGVEDLQPFDPQAFVNAIFP 330 >ref|XP_002961591.1| hypothetical protein SELMODRAFT_77470 [Selaginella moellendorffii] gi|302775590|ref|XP_002971212.1| hypothetical protein SELMODRAFT_95155 [Selaginella moellendorffii] gi|300161194|gb|EFJ27810.1| hypothetical protein SELMODRAFT_95155 [Selaginella moellendorffii] gi|300170250|gb|EFJ36851.1| hypothetical protein SELMODRAFT_77470 [Selaginella moellendorffii] Length = 333 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CV SVVDELGIPVKFVGVGEG+EDLQPFDAEAFVNA+FP Sbjct: 295 CVASVVDELGIPVKFVGVGEGLEDLQPFDAEAFVNALFP 333 >ref|XP_006645363.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Oryza brachyantha] Length = 363 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFV AIFP Sbjct: 325 CVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAIFP 363 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDA+AFVNAIF Sbjct: 333 CVVSVVDELGIPVKFVGVGEGVEDLQPFDADAFVNAIF 370 >ref|XP_004971321.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Setaria italica] Length = 360 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFV AIFP Sbjct: 322 CVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAIFP 360 >ref|XP_004971320.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Setaria italica] Length = 410 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 272 CVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFV AIFP Sbjct: 372 CVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEAIFP 410 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 388 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 275 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAE+FVNAIF Sbjct: 334 CVVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371