BLASTX nr result
ID: Mentha25_contig00001072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00001072 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26842.1| hypothetical protein MIMGU_mgv1a017580mg [Mimulus... 67 3e-09 ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, part... 60 2e-07 gb|ABK92573.1| unknown [Populus trichocarpa] gi|118482323|gb|ABK... 60 2e-07 gb|EYU45506.1| hypothetical protein MIMGU_mgv1a017587mg [Mimulus... 60 3e-07 ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus... 59 5e-07 gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] 59 7e-07 ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like,... 59 7e-07 ref|XP_004148205.1| PREDICTED: 60S ribosomal protein L29-1-like ... 59 7e-07 ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phas... 59 9e-07 gb|AFK42911.1| unknown [Medicago truncatula] 59 9e-07 ref|XP_007035751.1| Ribosomal L29e protein family [Theobroma cac... 58 1e-06 ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 58 1e-06 ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like ... 57 2e-06 ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatu... 57 2e-06 ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocar... 57 2e-06 ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glyc... 57 3e-06 ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Viti... 57 3e-06 ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like ... 56 5e-06 dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] 56 6e-06 gb|AFK48186.1| unknown [Lotus japonicus] 56 6e-06 >gb|EYU26842.1| hypothetical protein MIMGU_mgv1a017580mg [Mimulus guttatus] Length = 61 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 RNISTKGMDPKFLRNQRYARKHN K+ +GASGEE Sbjct: 28 RNISTKGMDPKFLRNQRYARKHNNKIADGASGEE 61 >ref|XP_002314927.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] gi|550329855|gb|EEF01098.2| hypothetical protein POPTR_0010s15190g, partial [Populus trichocarpa] Length = 108 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK DE A+ EE Sbjct: 75 RHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 108 >gb|ABK92573.1| unknown [Populus trichocarpa] gi|118482323|gb|ABK93087.1| unknown [Populus trichocarpa] gi|118483414|gb|ABK93607.1| unknown [Populus trichocarpa] Length = 61 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK DE A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKCDETATEEE 61 >gb|EYU45506.1| hypothetical protein MIMGU_mgv1a017587mg [Mimulus guttatus] gi|604347255|gb|EYU45507.1| hypothetical protein MIMGU_mgv1a017587mg [Mimulus guttatus] Length = 61 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 RNISTKGMDPKFLRNQRYARKHN K E +S EE Sbjct: 28 RNISTKGMDPKFLRNQRYARKHNNKTAEVSSAEE 61 >ref|XP_002519200.1| 60S ribosomal protein L29, putative [Ricinus communis] gi|223541515|gb|EEF43064.1| 60S ribosomal protein L29, putative [Ricinus communis] Length = 61 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 QRNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 QR+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 27 QRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >gb|ADV02780.1| putative 60S ribosomal protein L29 [Ipomoea batatas] Length = 61 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHN K E SGEE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNNKSGEAGSGEE 61 >ref|XP_004173787.1| PREDICTED: 60S ribosomal protein L29-1-like, partial [Cucumis sativus] Length = 85 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYA+KHN K E ASGEE Sbjct: 52 RHTSTKGMDPKFLRNQRYAKKHNTKSGENASGEE 85 >ref|XP_004148205.1| PREDICTED: 60S ribosomal protein L29-1-like [Cucumis sativus] Length = 61 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYA+KHN K E ASGEE Sbjct: 28 RHTSTKGMDPKFLRNQRYAKKHNTKSGENASGEE 61 >ref|XP_007138981.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|593782635|ref|XP_007154358.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] gi|561012068|gb|ESW10975.1| hypothetical protein PHAVU_009G254800g [Phaseolus vulgaris] gi|561027712|gb|ESW26352.1| hypothetical protein PHAVU_003G112200g [Phaseolus vulgaris] Length = 61 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E AS EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSGETASEEE 61 >gb|AFK42911.1| unknown [Medicago truncatula] Length = 61 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E AS EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKNGEVASAEE 61 >ref|XP_007035751.1| Ribosomal L29e protein family [Theobroma cacao] gi|508714780|gb|EOY06677.1| Ribosomal L29e protein family [Theobroma cacao] Length = 61 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >ref|XP_002276776.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147802163|emb|CAN65958.1| hypothetical protein VITISV_007494 [Vitis vinifera] gi|296083268|emb|CBI22904.3| unnamed protein product [Vitis vinifera] Length = 61 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 28 RHASTKGMDPKFLRNQRYARKHNKKSGESATEEE 61 >ref|XP_003529537.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356529227|ref|XP_003533197.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] gi|356564681|ref|XP_003550578.1| PREDICTED: 60S ribosomal protein L29-1-like [Glycine max] Length = 61 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE 61 >ref|XP_003609753.1| 60S ribosomal protein L29 [Medicago truncatula] gi|355510808|gb|AES91950.1| 60S ribosomal protein L29 [Medicago truncatula] Length = 445 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E AS E+ Sbjct: 164 RHTSTKGMDPKFLRNQRYARKHNKKNGEVASAED 197 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 412 RHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 445 >ref|XP_002312342.1| 60S ribosomal protein L29 [Populus trichocarpa] gi|118484518|gb|ABK94134.1| unknown [Populus trichocarpa] gi|222852162|gb|EEE89709.1| 60S ribosomal protein L29 [Populus trichocarpa] Length = 61 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK + A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKCGDSATEEE 61 >ref|XP_006597712.1| PREDICTED: 60S ribosomal protein L29-1 [Glycine max] Length = 61 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSGEIATEEE 61 >ref|XP_002275815.1| PREDICTED: 60S ribosomal protein L29-1 [Vitis vinifera] gi|147811184|emb|CAN63474.1| hypothetical protein VITISV_016797 [Vitis vinifera] gi|297743968|emb|CBI36938.3| unnamed protein product [Vitis vinifera] Length = 62 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK + A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKSEGSATEEE 61 >ref|XP_004508161.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X1 [Cicer arietinum] gi|502150865|ref|XP_004508162.1| PREDICTED: 60S ribosomal protein L29-1-like isoform X2 [Cicer arietinum] gi|388515093|gb|AFK45608.1| unknown [Medicago truncatula] Length = 61 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E A+ EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKNGEIATEEE 61 >dbj|BAA96072.1| ribosomal protein L29 [Panax ginseng] Length = 61 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ ST+GMDPKFLRNQRYARKHN K E A+ EE Sbjct: 28 RHTSTRGMDPKFLRNQRYARKHNNKTGESATEEE 61 >gb|AFK48186.1| unknown [Lotus japonicus] Length = 61 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 6 RNISTKGMDPKFLRNQRYARKHNKKVDEGASGEE 107 R+ STKGMDPKFLRNQRYARKHNKK E + EE Sbjct: 28 RHTSTKGMDPKFLRNQRYARKHNKKGAESVTEEE 61