BLASTX nr result
ID: Mentha25_contig00000967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00000967 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37073.1| hypothetical protein MIMGU_mgv1a013649mg [Mimulus... 71 1e-10 >gb|EYU37073.1| hypothetical protein MIMGU_mgv1a013649mg [Mimulus guttatus] Length = 214 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/43 (74%), Positives = 41/43 (95%) Frame = -2 Query: 192 VCAASKRNRYGIAKSGKLMLESAFIVASHLRILPEPVELLLRE 64 +CAA++RNRYGI KSGKL+L+SAFI+AS LR+LPEP+EL+LRE Sbjct: 44 LCAANRRNRYGIGKSGKLILDSAFIIASKLRLLPEPLELILRE 86