BLASTX nr result
ID: Mentha25_contig00000913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00000913 (889 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44565.1| hypothetical protein MIMGU_mgv1a015143mg [Mimulus... 65 3e-08 ref|XP_007216470.1| hypothetical protein PRUPE_ppa025942mg [Prun... 62 2e-07 gb|EXC20649.1| putative ADP-ribosylation factor GTPase-activatin... 61 7e-07 ref|XP_004288398.1| PREDICTED: probable ADP-ribosylation factor ... 61 7e-07 gb|EYU33973.1| hypothetical protein MIMGU_mgv1a014822mg [Mimulus... 60 9e-07 ref|XP_002282569.1| PREDICTED: probable ADP-ribosylation factor ... 60 9e-07 emb|CAN69475.1| hypothetical protein VITISV_014376 [Vitis vinife... 60 9e-07 ref|XP_006301267.1| hypothetical protein CARUB_v10021667mg [Caps... 60 1e-06 ref|XP_006430620.1| hypothetical protein CICLE_v10012950mg [Citr... 60 1e-06 ref|XP_004231985.1| PREDICTED: probable ADP-ribosylation factor ... 60 1e-06 ref|XP_004503138.1| PREDICTED: probable ADP-ribosylation factor ... 59 3e-06 ref|XP_004235814.1| PREDICTED: probable ADP-ribosylation factor ... 59 3e-06 ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus comm... 59 3e-06 gb|ACJ83963.1| unknown [Medicago truncatula] gi|388509716|gb|AFK... 59 3e-06 ref|XP_007152688.1| hypothetical protein PHAVU_004G150800g [Phas... 59 3e-06 ref|XP_004235812.1| PREDICTED: probable ADP-ribosylation factor ... 59 3e-06 ref|XP_004231984.1| PREDICTED: probable ADP-ribosylation factor ... 59 3e-06 ref|XP_003619827.1| Multiple C2 and transmembrane domain-contain... 59 3e-06 ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor ... 58 4e-06 dbj|BAO02515.1| predicted C2 domain containing protein [Nicotian... 58 4e-06 >gb|EYU44565.1| hypothetical protein MIMGU_mgv1a015143mg [Mimulus guttatus] Length = 167 Score = 65.5 bits (158), Expect = 3e-08 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKNLNPEWNEELTLTI+DPN PIKL Sbjct: 37 QKLKTRVVKKNLNPEWNEELTLTISDPNIPIKL 69 >ref|XP_007216470.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica] gi|462412620|gb|EMJ17669.1| hypothetical protein PRUPE_ppa025942mg [Prunus persica] Length = 165 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QKVKTRVVKKN+NPEWNE+LTL++ADPN PI+L Sbjct: 37 QKVKTRVVKKNVNPEWNEDLTLSVADPNLPIRL 69 >gb|EXC20649.1| putative ADP-ribosylation factor GTPase-activating protein AGD11 [Morus notabilis] Length = 165 Score = 60.8 bits (146), Expect = 7e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKNLNPEWNE LTL+++DPN PIKL Sbjct: 37 QKLKTRVVKKNLNPEWNELLTLSVSDPNTPIKL 69 >ref|XP_004288398.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Fragaria vesca subsp. vesca] Length = 163 Score = 60.8 bits (146), Expect = 7e-07 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVK+N+NPEWNE+LTLT++DPN P+KL Sbjct: 37 QKLKTRVVKRNVNPEWNEKLTLTVSDPNIPVKL 69 >gb|EYU33973.1| hypothetical protein MIMGU_mgv1a014822mg [Mimulus guttatus] Length = 177 Score = 60.5 bits (145), Expect = 9e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRV++KN+NPEWNE+LTL+IADPNH I L Sbjct: 49 QKLKTRVIRKNVNPEWNEDLTLSIADPNHTISL 81 >ref|XP_002282569.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Vitis vinifera] Length = 181 Score = 60.5 bits (145), Expect = 9e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRV+KKN+NPEWNE+LTL+I+DPN PIKL Sbjct: 53 QKLKTRVMKKNVNPEWNEDLTLSISDPNLPIKL 85 >emb|CAN69475.1| hypothetical protein VITISV_014376 [Vitis vinifera] gi|297734335|emb|CBI15582.3| unnamed protein product [Vitis vinifera] Length = 165 Score = 60.5 bits (145), Expect = 9e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRV+KKN+NPEWNE+LTL+I+DPN PIKL Sbjct: 37 QKLKTRVMKKNVNPEWNEDLTLSISDPNLPIKL 69 >ref|XP_006301267.1| hypothetical protein CARUB_v10021667mg [Capsella rubella] gi|482569977|gb|EOA34165.1| hypothetical protein CARUB_v10021667mg [Capsella rubella] Length = 168 Score = 60.1 bits (144), Expect = 1e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKLV 779 QK+KTRVVKKN+NP+W E+LT T+ DPNHP+ L+ Sbjct: 40 QKLKTRVVKKNINPQWEEDLTFTVTDPNHPLTLI 73 >ref|XP_006430620.1| hypothetical protein CICLE_v10012950mg [Citrus clementina] gi|557532677|gb|ESR43860.1| hypothetical protein CICLE_v10012950mg [Citrus clementina] Length = 165 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVK N+NPEWNE+LTL+I+DPN PIKL Sbjct: 37 QKLKTRVVKNNVNPEWNEDLTLSISDPNLPIKL 69 >ref|XP_004231985.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like isoform 2 [Solanum lycopersicum] Length = 152 Score = 59.7 bits (143), Expect = 1e-06 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 5/57 (8%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKLVTNSF-----FLS*PLKIHKNHPN 833 QK+KTRVVKKNLNPEWNEELTL+I +P PIKL+ ++ F+ K +KN P+ Sbjct: 37 QKLKTRVVKKNLNPEWNEELTLSITEPILPIKLMGDAEVDIQPFIDAARKRYKNIPS 93 >ref|XP_004503138.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like [Cicer arietinum] Length = 167 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKNLNPEWNE+LTL+I+DP PI L Sbjct: 39 QKLKTRVVKKNLNPEWNEDLTLSISDPRTPISL 71 >ref|XP_004235814.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like isoform 3 [Solanum lycopersicum] Length = 165 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +3 Query: 669 LMDQKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 + +QK+KTRVVKK++NPEWNE+LTL++ADPN P+ L Sbjct: 34 MAEQKLKTRVVKKDVNPEWNEDLTLSVADPNLPVML 69 >ref|XP_002534010.1| ARF GTPase activator, putative [Ricinus communis] gi|223525988|gb|EEF28372.1| ARF GTPase activator, putative [Ricinus communis] Length = 169 Score = 58.9 bits (141), Expect = 3e-06 Identities = 24/33 (72%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKN+NPEWNE+LTL+I++PN P+K+ Sbjct: 41 QKLKTRVVKKNINPEWNEDLTLSISNPNLPVKI 73 >gb|ACJ83963.1| unknown [Medicago truncatula] gi|388509716|gb|AFK42924.1| unknown [Medicago truncatula] Length = 165 Score = 58.9 bits (141), Expect = 3e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKNLNPEWNE+LTL+I+DP+ PI L Sbjct: 37 QKLKTRVVKKNLNPEWNEDLTLSISDPHTPIHL 69 >ref|XP_007152688.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris] gi|561025997|gb|ESW24682.1| hypothetical protein PHAVU_004G150800g [Phaseolus vulgaris] Length = 176 Score = 58.5 bits (140), Expect = 3e-06 Identities = 22/37 (59%), Positives = 33/37 (89%) Frame = +3 Query: 669 LMDQKVKTRVVKKNLNPEWNEELTLTIADPNHPIKLV 779 + +QK+KTR ++K++NPEWNE+LTL+I DPNH +KL+ Sbjct: 45 MFNQKLKTRFIRKDVNPEWNEDLTLSIIDPNHQVKLI 81 >ref|XP_004235812.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13-like isoform 1 [Solanum lycopersicum] Length = 165 Score = 58.5 bits (140), Expect = 3e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +3 Query: 669 LMDQKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 + +QK+KTRV+KK++NPEWNE+LTL++ADPN P+ L Sbjct: 34 MAEQKLKTRVIKKDVNPEWNEDLTLSVADPNLPVML 69 >ref|XP_004231984.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD11-like isoform 1 [Solanum lycopersicum] Length = 165 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRVVKKNLNPEWNEELTL+I +P PIKL Sbjct: 37 QKLKTRVVKKNLNPEWNEELTLSITEPILPIKL 69 >ref|XP_003619827.1| Multiple C2 and transmembrane domain-containing protein [Medicago truncatula] gi|355494842|gb|AES76045.1| Multiple C2 and transmembrane domain-containing protein [Medicago truncatula] Length = 177 Score = 58.5 bits (140), Expect = 3e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = +3 Query: 669 LMDQKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 + +QK+KT V KKN+NPEWNE+LTL++ DPNHP+ L Sbjct: 46 MYNQKLKTHVKKKNVNPEWNEDLTLSVIDPNHPVTL 81 >ref|XP_003534141.2| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD13 isoform X1 [Glycine max] Length = 204 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +3 Query: 669 LMDQKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 + +QK+KTRV+KK++NPEWNE+LTL++ +PNH IKL Sbjct: 73 MYNQKLKTRVIKKDVNPEWNEDLTLSVINPNHKIKL 108 >dbj|BAO02515.1| predicted C2 domain containing protein [Nicotiana alata] Length = 188 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/33 (69%), Positives = 32/33 (96%) Frame = +3 Query: 678 QKVKTRVVKKNLNPEWNEELTLTIADPNHPIKL 776 QK+KTRV+KK++NPEWNEELTL+++DP+ P+KL Sbjct: 60 QKLKTRVIKKDINPEWNEELTLSVSDPSLPVKL 92