BLASTX nr result
ID: Mentha25_contig00000694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00000694 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45514.1| hypothetical protein MIMGU_mgv1a010584mg [Mimulus... 58 1e-06 gb|EYU45513.1| hypothetical protein MIMGU_mgv1a010452mg [Mimulus... 55 8e-06 >gb|EYU45514.1| hypothetical protein MIMGU_mgv1a010584mg [Mimulus guttatus] Length = 308 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 3 DNEIKNYWNSHLSRKIYRYRYI-GEATLSASDM 98 DNEIKNYWNSHLSR IYR+R I GE+TLSASDM Sbjct: 101 DNEIKNYWNSHLSRSIYRFRSINGESTLSASDM 133 >gb|EYU45513.1| hypothetical protein MIMGU_mgv1a010452mg [Mimulus guttatus] Length = 312 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 2/34 (5%) Frame = +3 Query: 3 DNEIKNYWNSHLSRKIYRYRYIG--EATLSASDM 98 DNEIKNYWNSHLSR IYR+R I E+TLSASDM Sbjct: 82 DNEIKNYWNSHLSRSIYRFRSINGHESTLSASDM 115