BLASTX nr result
ID: Mentha25_contig00000623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00000623 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232394.1| PREDICTED: U1 small nuclear ribonucleoprotei... 57 3e-06 ref|XP_004232393.1| PREDICTED: U1 small nuclear ribonucleoprotei... 57 3e-06 gb|EYU40151.1| hypothetical protein MIMGU_mgv1a005568mg [Mimulus... 56 6e-06 >ref|XP_004232394.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like isoform 2 [Solanum lycopersicum] Length = 390 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +3 Query: 6 DRYDQMDDDGYSYDRAASE--PQDRDYRHSDRSRPREYEY 119 DRYDQM++D Y+YD ASE +DRDY+ SDRS REY+Y Sbjct: 351 DRYDQMEEDNYAYDHGASETKERDRDYKRSDRSHSREYDY 390 >ref|XP_004232393.1| PREDICTED: U1 small nuclear ribonucleoprotein 70 kDa-like isoform 1 [Solanum lycopersicum] Length = 482 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/40 (62%), Positives = 31/40 (77%), Gaps = 2/40 (5%) Frame = +3 Query: 6 DRYDQMDDDGYSYDRAASE--PQDRDYRHSDRSRPREYEY 119 DRYDQM++D Y+YD ASE +DRDY+ SDRS REY+Y Sbjct: 443 DRYDQMEEDNYAYDHGASETKERDRDYKRSDRSHSREYDY 482 >gb|EYU40151.1| hypothetical protein MIMGU_mgv1a005568mg [Mimulus guttatus] Length = 479 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +3 Query: 6 DRYDQM-DDDGYSYDRAASEPQDRDYRHSDRSRPREYEY 119 DRY QM DDDGY Y+R SEP+DR YR SDRS RE EY Sbjct: 441 DRYGQMEDDDGYGYERGVSEPRDRAYRRSDRSVSREAEY 479