BLASTX nr result
ID: Mentha24_contig00049381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00049381 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207613.1| hypothetical protein PRUPE_ppa020006mg [Prun... 66 4e-09 gb|EYU45677.1| hypothetical protein MIMGU_mgv1a006616mg [Mimulus... 57 4e-06 >ref|XP_007207613.1| hypothetical protein PRUPE_ppa020006mg [Prunus persica] gi|462403255|gb|EMJ08812.1| hypothetical protein PRUPE_ppa020006mg [Prunus persica] Length = 442 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 180 MEFAACSKPLKPPANIADIVSKFAKVCKFRSIGVFTTSESVDHSHVYP 37 MEFA KPLKP +NI+DIVSKFAKVCK RSIGVF TSE+ DH H +P Sbjct: 1 MEFAT-PKPLKPSSNISDIVSKFAKVCKLRSIGVF-TSENQDHHHQHP 46 >gb|EYU45677.1| hypothetical protein MIMGU_mgv1a006616mg [Mimulus guttatus] Length = 437 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 180 MEFAACSKPLKPPANIADIVSKFAKVCKFRSIGVFTTSESVD 55 ME A SKPLKP + I+D VSKFAKV +FRSIGVF TSE +D Sbjct: 1 MEDAPSSKPLKPSSIISDRVSKFAKVSRFRSIGVFNTSEDLD 42