BLASTX nr result
ID: Mentha24_contig00049186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00049186 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74031.1| hypothetical protein M569_00731, partial [Genlise... 57 3e-06 gb|EYU37153.1| hypothetical protein MIMGU_mgv1a019184mg [Mimulus... 56 6e-06 >gb|EPS74031.1| hypothetical protein M569_00731, partial [Genlisea aurea] Length = 108 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 439 EISSLKEALCAQQFLLQKLYNELDAEREASASA 537 EI SLKE LCAQQ LLQKLYNELDAEREASA+A Sbjct: 1 EIRSLKETLCAQQKLLQKLYNELDAEREASATA 33 >gb|EYU37153.1| hypothetical protein MIMGU_mgv1a019184mg [Mimulus guttatus] Length = 398 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = +1 Query: 397 MADDDKTPPFSDGDEISSLKEALCAQQFLLQKLYNELDAEREASASA 537 MAD + T DE+S+LKE L AQQ LLQKLYNELDAEREASA+A Sbjct: 1 MADYNST--VMSPDEVSALKETLYAQQKLLQKLYNELDAEREASATA 45