BLASTX nr result
ID: Mentha24_contig00049154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00049154 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 82 8e-14 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 68 1e-09 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 82.0 bits (201), Expect = 8e-14 Identities = 43/67 (64%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = -1 Query: 432 LRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESG-PSLHL*PTVLKPT*NALSRPRVRR 256 LRGPLVGPDRWWYHTLLK TVRDTLASYGS PESG P VL+PT AL P + Sbjct: 3 LRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFPALDAPPTLK 62 Query: 255 PFLSPVP 235 S +P Sbjct: 63 GSCSLLP 69 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 67.8 bits (164), Expect = 1e-09 Identities = 39/68 (57%), Positives = 44/68 (64%) Frame = -2 Query: 404 GGGITPFSKKPYVTLSRHTAPSRNQDLPCIFDQRSSNQPETHSVVPGCVVPFYLRSREAQ 225 GGGITPFSK+PYVTLSRHTAPSRN+DLP SSNQP V PFY S A Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQP---------VPPFY--SSVAV 68 Query: 224 SQFKIDRL 201 + F++ L Sbjct: 69 ACFQVQAL 76